Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5YQV4

Protein Details
Accession A0A2C5YQV4    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
91-122TTREQPTTTRKRQTRPGTTRPPPHRRYTPRASHydrophilic
NLS Segment(s)
PositionSequence
6-6R
15-69PEPASASKKPRRGGFRVGPDNLPDGPWRRKVTKIKKDLIHRAKVKKAYAKIKARQ
Subcellular Location(s) nucl 17, mito 5, cyto 4
Family & Domain DBs
Amino Acid Sequences MAAKKRKEQEAEPEPEPASASKKPRRGGFRVGPDNLPDGPWRRKVTKIKKDLIHRAKVKKAYAKIKARQPSGPAGSGDDDDDEHDGTGTTTTREQPTTTRKRQTRPGTTRPPPHRRYTPRAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.44
3 0.39
4 0.3
5 0.26
6 0.25
7 0.33
8 0.37
9 0.44
10 0.49
11 0.56
12 0.62
13 0.62
14 0.66
15 0.65
16 0.67
17 0.68
18 0.65
19 0.59
20 0.53
21 0.49
22 0.4
23 0.32
24 0.25
25 0.23
26 0.25
27 0.31
28 0.34
29 0.34
30 0.42
31 0.52
32 0.6
33 0.64
34 0.68
35 0.68
36 0.7
37 0.76
38 0.78
39 0.75
40 0.73
41 0.7
42 0.67
43 0.65
44 0.64
45 0.6
46 0.55
47 0.54
48 0.53
49 0.55
50 0.58
51 0.58
52 0.61
53 0.64
54 0.61
55 0.56
56 0.51
57 0.48
58 0.41
59 0.37
60 0.29
61 0.25
62 0.23
63 0.21
64 0.18
65 0.12
66 0.1
67 0.09
68 0.09
69 0.08
70 0.07
71 0.06
72 0.06
73 0.06
74 0.07
75 0.07
76 0.07
77 0.09
78 0.12
79 0.14
80 0.15
81 0.16
82 0.22
83 0.33
84 0.42
85 0.49
86 0.56
87 0.61
88 0.67
89 0.76
90 0.8
91 0.81
92 0.8
93 0.81
94 0.82
95 0.85
96 0.88
97 0.88
98 0.88
99 0.83
100 0.83
101 0.84
102 0.82