Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C6ALV1

Protein Details
Accession A0A2C6ALV1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
260-287GEFLRYNAKVNKKRIRDQKDVNGRTRGPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 17, E.R. 3, golg 3, mito 2, vacu 2
Family & Domain DBs
Amino Acid Sequences MKYAVFLAALAAVQAAVHAMPARFEGLGEAAAAARAAKAAKAAKDNPTKASAAAAAATGTPAGGTAGEPHGPCRPDPPTDDVACATPGDDDGSVAEPEGADEDRSGAGDLGNGKTAASNGDSTKPGDDVGSNAKPKGADNDKPRGVPLSRDNTQDGAPPPSAEEAKATGASADGGSASGPSSHGQVRHCDNCDVVNHYNSPEACGETESKYWKKWDSTLTKPKDDKELALLSEATKAYLLYNGPLNKEPGFKWAWEEAEGEFLRYNAKVNKKRIRDQKDVNGRTRGPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.04
5 0.07
6 0.07
7 0.08
8 0.09
9 0.1
10 0.1
11 0.1
12 0.1
13 0.09
14 0.1
15 0.09
16 0.08
17 0.07
18 0.07
19 0.07
20 0.06
21 0.05
22 0.06
23 0.06
24 0.06
25 0.11
26 0.15
27 0.19
28 0.26
29 0.3
30 0.38
31 0.47
32 0.5
33 0.48
34 0.48
35 0.45
36 0.38
37 0.36
38 0.27
39 0.19
40 0.16
41 0.13
42 0.09
43 0.08
44 0.08
45 0.06
46 0.05
47 0.04
48 0.04
49 0.04
50 0.03
51 0.04
52 0.06
53 0.08
54 0.11
55 0.11
56 0.13
57 0.18
58 0.18
59 0.19
60 0.22
61 0.24
62 0.24
63 0.28
64 0.32
65 0.33
66 0.33
67 0.34
68 0.3
69 0.28
70 0.25
71 0.21
72 0.15
73 0.09
74 0.08
75 0.08
76 0.07
77 0.06
78 0.06
79 0.08
80 0.08
81 0.07
82 0.07
83 0.06
84 0.06
85 0.07
86 0.07
87 0.05
88 0.05
89 0.06
90 0.06
91 0.07
92 0.07
93 0.06
94 0.05
95 0.06
96 0.08
97 0.08
98 0.09
99 0.08
100 0.08
101 0.08
102 0.08
103 0.08
104 0.07
105 0.08
106 0.09
107 0.11
108 0.13
109 0.13
110 0.13
111 0.13
112 0.12
113 0.1
114 0.09
115 0.08
116 0.13
117 0.17
118 0.17
119 0.17
120 0.18
121 0.18
122 0.18
123 0.23
124 0.23
125 0.25
126 0.3
127 0.38
128 0.39
129 0.39
130 0.39
131 0.35
132 0.3
133 0.27
134 0.28
135 0.27
136 0.28
137 0.3
138 0.31
139 0.29
140 0.29
141 0.28
142 0.23
143 0.19
144 0.17
145 0.15
146 0.14
147 0.15
148 0.15
149 0.11
150 0.11
151 0.09
152 0.1
153 0.1
154 0.09
155 0.07
156 0.07
157 0.07
158 0.06
159 0.05
160 0.04
161 0.03
162 0.03
163 0.04
164 0.04
165 0.03
166 0.05
167 0.05
168 0.07
169 0.09
170 0.12
171 0.13
172 0.18
173 0.24
174 0.28
175 0.3
176 0.29
177 0.28
178 0.27
179 0.28
180 0.3
181 0.26
182 0.23
183 0.21
184 0.21
185 0.24
186 0.22
187 0.22
188 0.17
189 0.16
190 0.14
191 0.15
192 0.16
193 0.15
194 0.18
195 0.22
196 0.24
197 0.25
198 0.29
199 0.32
200 0.33
201 0.35
202 0.42
203 0.43
204 0.51
205 0.59
206 0.62
207 0.66
208 0.66
209 0.64
210 0.63
211 0.57
212 0.48
213 0.43
214 0.4
215 0.32
216 0.31
217 0.29
218 0.2
219 0.23
220 0.21
221 0.15
222 0.12
223 0.12
224 0.1
225 0.12
226 0.12
227 0.1
228 0.17
229 0.18
230 0.22
231 0.24
232 0.26
233 0.25
234 0.28
235 0.27
236 0.26
237 0.26
238 0.24
239 0.27
240 0.28
241 0.28
242 0.26
243 0.27
244 0.22
245 0.28
246 0.27
247 0.24
248 0.2
249 0.18
250 0.19
251 0.18
252 0.22
253 0.22
254 0.33
255 0.4
256 0.5
257 0.6
258 0.66
259 0.76
260 0.82
261 0.83
262 0.83
263 0.84
264 0.84
265 0.86
266 0.85
267 0.83
268 0.8