Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8M0R2

Protein Details
Accession B8M0R2    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPSATGGKKQKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
8-23GKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 11, mito_nucl 10.833, mito 9.5, cyto_nucl 8.333, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPSATGGKKQKKKWSKGKVKDKAQHAVVLDKTTSEKLYKDVQSYRLITVATLVDRLKINGSLARKALADLEEKGQIKKVVGHSSLNIYTRAVTAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.88
4 0.9
5 0.93
6 0.92
7 0.92
8 0.89
9 0.85
10 0.82
11 0.72
12 0.65
13 0.55
14 0.5
15 0.4
16 0.34
17 0.27
18 0.2
19 0.2
20 0.17
21 0.17
22 0.13
23 0.12
24 0.13
25 0.2
26 0.21
27 0.24
28 0.26
29 0.28
30 0.31
31 0.32
32 0.29
33 0.24
34 0.22
35 0.17
36 0.16
37 0.13
38 0.08
39 0.09
40 0.08
41 0.09
42 0.09
43 0.1
44 0.1
45 0.09
46 0.1
47 0.12
48 0.15
49 0.16
50 0.16
51 0.17
52 0.16
53 0.16
54 0.17
55 0.15
56 0.15
57 0.13
58 0.15
59 0.2
60 0.21
61 0.21
62 0.23
63 0.22
64 0.21
65 0.25
66 0.28
67 0.3
68 0.32
69 0.33
70 0.32
71 0.37
72 0.4
73 0.36
74 0.32
75 0.25
76 0.23