Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5ZS14

Protein Details
Accession A0A2C5ZS14    Localization Confidence High Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
12-35NQQFCSFKLKTEKKQNFCRNEYNVHydrophilic
275-311DSEAEKDKTGRKRKRAKVVKMAKKRTKQDEAERPRLTBasic
NLS Segment(s)
PositionSequence
281-301DKTGRKRKRAKVVKMAKKRTK
Subcellular Location(s) nucl 21, cyto 3, mito 1, pero 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR029004  L28e/Mak16  
IPR006958  Mak16  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF04874  Mak16  
PF01778  Ribosomal_L28e  
Amino Acid Sequences MASDEIVWQIINQQFCSFKLKTEKKQNFCRNEYNVTGLCNRQSCPLANSRYATVRQHPTKQTLYLYMKTIERAHLPSKMWERIKLSNNYSKALEQLDERLLYWPKFLVHKCKQRLTRLTQVQMRTRRLAAEEERLGETLVPRLAPKVQHRERTRERKAEAAAKLERTIERELVERLRQGAYGDQPLNVSEGIWKKVLNAMEREGDGTRDEDMDQGIEEDEEDEGLAVVEEAEDDDKMVEYVSDMSESELDELEDWLESDEDEDEDEDDEDEDDEDSEAEKDKTGRKRKRAKVVKMAKKRTKQDEAERPRLTLTQELAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.32
4 0.26
5 0.29
6 0.38
7 0.47
8 0.54
9 0.64
10 0.72
11 0.74
12 0.85
13 0.88
14 0.87
15 0.84
16 0.83
17 0.78
18 0.75
19 0.68
20 0.63
21 0.54
22 0.48
23 0.44
24 0.38
25 0.36
26 0.32
27 0.31
28 0.29
29 0.31
30 0.3
31 0.31
32 0.37
33 0.37
34 0.39
35 0.4
36 0.38
37 0.4
38 0.42
39 0.42
40 0.41
41 0.46
42 0.48
43 0.54
44 0.56
45 0.58
46 0.58
47 0.57
48 0.51
49 0.5
50 0.49
51 0.44
52 0.41
53 0.38
54 0.35
55 0.34
56 0.34
57 0.27
58 0.25
59 0.27
60 0.27
61 0.29
62 0.29
63 0.33
64 0.38
65 0.44
66 0.43
67 0.43
68 0.45
69 0.48
70 0.54
71 0.54
72 0.54
73 0.53
74 0.53
75 0.51
76 0.47
77 0.4
78 0.34
79 0.29
80 0.23
81 0.16
82 0.17
83 0.18
84 0.16
85 0.16
86 0.18
87 0.2
88 0.19
89 0.18
90 0.16
91 0.16
92 0.21
93 0.24
94 0.3
95 0.37
96 0.46
97 0.52
98 0.59
99 0.64
100 0.67
101 0.72
102 0.69
103 0.7
104 0.67
105 0.67
106 0.64
107 0.63
108 0.62
109 0.61
110 0.58
111 0.5
112 0.44
113 0.38
114 0.35
115 0.34
116 0.29
117 0.28
118 0.26
119 0.25
120 0.25
121 0.24
122 0.22
123 0.17
124 0.15
125 0.1
126 0.09
127 0.08
128 0.07
129 0.08
130 0.1
131 0.14
132 0.2
133 0.29
134 0.34
135 0.43
136 0.46
137 0.55
138 0.63
139 0.69
140 0.71
141 0.67
142 0.62
143 0.58
144 0.58
145 0.56
146 0.47
147 0.42
148 0.37
149 0.31
150 0.31
151 0.27
152 0.25
153 0.21
154 0.2
155 0.16
156 0.14
157 0.15
158 0.16
159 0.17
160 0.18
161 0.15
162 0.15
163 0.15
164 0.14
165 0.13
166 0.14
167 0.13
168 0.17
169 0.16
170 0.15
171 0.15
172 0.15
173 0.15
174 0.13
175 0.11
176 0.1
177 0.12
178 0.13
179 0.14
180 0.14
181 0.13
182 0.17
183 0.2
184 0.18
185 0.18
186 0.19
187 0.2
188 0.2
189 0.21
190 0.18
191 0.16
192 0.14
193 0.12
194 0.1
195 0.1
196 0.1
197 0.08
198 0.08
199 0.08
200 0.07
201 0.06
202 0.06
203 0.05
204 0.05
205 0.05
206 0.05
207 0.04
208 0.04
209 0.04
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.02
216 0.03
217 0.03
218 0.04
219 0.04
220 0.04
221 0.04
222 0.04
223 0.05
224 0.05
225 0.04
226 0.04
227 0.06
228 0.06
229 0.06
230 0.06
231 0.07
232 0.08
233 0.08
234 0.08
235 0.08
236 0.07
237 0.07
238 0.07
239 0.07
240 0.06
241 0.06
242 0.06
243 0.06
244 0.05
245 0.06
246 0.06
247 0.06
248 0.07
249 0.07
250 0.07
251 0.08
252 0.08
253 0.08
254 0.07
255 0.08
256 0.07
257 0.08
258 0.07
259 0.07
260 0.07
261 0.07
262 0.07
263 0.07
264 0.09
265 0.09
266 0.11
267 0.14
268 0.22
269 0.32
270 0.42
271 0.52
272 0.6
273 0.71
274 0.79
275 0.87
276 0.9
277 0.9
278 0.9
279 0.91
280 0.92
281 0.92
282 0.93
283 0.92
284 0.91
285 0.9
286 0.89
287 0.88
288 0.86
289 0.86
290 0.86
291 0.86
292 0.86
293 0.79
294 0.7
295 0.63
296 0.56
297 0.48
298 0.43