Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C6A573

Protein Details
Accession A0A2C6A573    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
61-87SPLPQPPRPETRCKRRKKVSVSSVWACHydrophilic
NLS Segment(s)
PositionSequence
245-248RRRR
Subcellular Location(s) nucl 12, mito 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MQLLAVAELRAEKPFVCSIPTRPVGRYPAPCPGYLARAEGEKGRFRAGTTYLDRNVRPLPSPLPQPPRPETRCKRRKKVSVSSVWACDDGDRGHNSRRRQAVWLETARYPLLPSQVVAAPKTAKVSRYLRRAARPSPLSASPGYRSWVPRPGQVPLPEPWPPAHRGRPVADTCEPGPADAVLQMPIRTRYLRPRLQQVHAALRMRPSLARYLACYPAVKPRCLAIDHEAASPPPASPHGPPSLARRRRRLGLGLRFSVPEDRDDELAGRPRPTRLPPPIAARPSAAACRPERAAADIPDAPPPLSSLPAPKPPLVGIDRPPPPPPEPCADIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.21
4 0.23
5 0.27
6 0.35
7 0.42
8 0.41
9 0.4
10 0.45
11 0.48
12 0.53
13 0.54
14 0.49
15 0.53
16 0.52
17 0.5
18 0.48
19 0.43
20 0.4
21 0.35
22 0.33
23 0.24
24 0.24
25 0.25
26 0.26
27 0.29
28 0.3
29 0.31
30 0.32
31 0.31
32 0.3
33 0.33
34 0.3
35 0.33
36 0.32
37 0.37
38 0.39
39 0.43
40 0.42
41 0.42
42 0.42
43 0.37
44 0.34
45 0.31
46 0.3
47 0.31
48 0.38
49 0.42
50 0.47
51 0.5
52 0.55
53 0.56
54 0.62
55 0.63
56 0.67
57 0.69
58 0.71
59 0.76
60 0.8
61 0.85
62 0.85
63 0.9
64 0.89
65 0.89
66 0.88
67 0.88
68 0.85
69 0.79
70 0.71
71 0.63
72 0.53
73 0.42
74 0.32
75 0.24
76 0.17
77 0.17
78 0.17
79 0.19
80 0.26
81 0.31
82 0.35
83 0.4
84 0.44
85 0.42
86 0.43
87 0.45
88 0.44
89 0.47
90 0.47
91 0.43
92 0.38
93 0.38
94 0.34
95 0.3
96 0.24
97 0.17
98 0.16
99 0.12
100 0.12
101 0.12
102 0.15
103 0.16
104 0.15
105 0.16
106 0.14
107 0.14
108 0.18
109 0.17
110 0.15
111 0.21
112 0.28
113 0.33
114 0.4
115 0.46
116 0.48
117 0.54
118 0.59
119 0.56
120 0.56
121 0.52
122 0.47
123 0.44
124 0.39
125 0.34
126 0.3
127 0.29
128 0.22
129 0.21
130 0.2
131 0.19
132 0.21
133 0.21
134 0.27
135 0.26
136 0.28
137 0.29
138 0.3
139 0.32
140 0.31
141 0.32
142 0.25
143 0.28
144 0.25
145 0.24
146 0.23
147 0.21
148 0.22
149 0.24
150 0.28
151 0.28
152 0.3
153 0.31
154 0.36
155 0.34
156 0.36
157 0.33
158 0.29
159 0.26
160 0.26
161 0.24
162 0.18
163 0.17
164 0.12
165 0.1
166 0.09
167 0.09
168 0.06
169 0.07
170 0.08
171 0.08
172 0.1
173 0.11
174 0.12
175 0.14
176 0.22
177 0.31
178 0.37
179 0.39
180 0.48
181 0.52
182 0.53
183 0.56
184 0.51
185 0.49
186 0.47
187 0.46
188 0.36
189 0.33
190 0.31
191 0.26
192 0.23
193 0.17
194 0.17
195 0.18
196 0.18
197 0.19
198 0.22
199 0.23
200 0.24
201 0.23
202 0.2
203 0.27
204 0.3
205 0.28
206 0.25
207 0.24
208 0.26
209 0.26
210 0.28
211 0.23
212 0.26
213 0.27
214 0.28
215 0.26
216 0.23
217 0.23
218 0.2
219 0.15
220 0.1
221 0.1
222 0.11
223 0.12
224 0.17
225 0.2
226 0.21
227 0.23
228 0.31
229 0.4
230 0.48
231 0.53
232 0.57
233 0.59
234 0.62
235 0.65
236 0.65
237 0.64
238 0.65
239 0.65
240 0.6
241 0.56
242 0.51
243 0.48
244 0.44
245 0.35
246 0.26
247 0.22
248 0.2
249 0.2
250 0.2
251 0.2
252 0.19
253 0.26
254 0.26
255 0.27
256 0.26
257 0.29
258 0.33
259 0.38
260 0.43
261 0.44
262 0.49
263 0.51
264 0.58
265 0.64
266 0.62
267 0.57
268 0.49
269 0.43
270 0.39
271 0.38
272 0.33
273 0.31
274 0.29
275 0.32
276 0.32
277 0.32
278 0.3
279 0.31
280 0.32
281 0.29
282 0.33
283 0.31
284 0.31
285 0.32
286 0.32
287 0.27
288 0.22
289 0.22
290 0.18
291 0.17
292 0.17
293 0.21
294 0.26
295 0.34
296 0.38
297 0.36
298 0.37
299 0.36
300 0.41
301 0.39
302 0.38
303 0.36
304 0.41
305 0.45
306 0.47
307 0.5
308 0.48
309 0.47
310 0.47
311 0.46
312 0.44