Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C6A1P7

Protein Details
Accession A0A2C6A1P7    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
39-58STGRGPAKGKIKNKKTRAEVHydrophilic
202-221SPSACLRRRPTPRRSLITGGHydrophilic
NLS Segment(s)
PositionSequence
42-54RGPAKGKIKNKKT
208-228RRRPTPRRSLITGGRRRKAGK
Subcellular Location(s) extr 14, plas 8, E.R. 2, nucl 1, mito 1, vacu 1, mito_nucl 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYRPCACTSTGRAAACLLLATAGSRSSDLHTHQAEASRSTGRGPAKGKIKNKKTRAEVGCASLSASATGQSQRPAPAIGPGALSALGCGCPLTASPISLDNPLQSAQRSQWPASLTAQRLPTCWVYYFPRLDARPCSDSVCLLRRLCLPSAAGLFVLCLGLVPRRRPGRFFPRLFFPLSVLLLLLLILSFSSSASYAAAFESPSACLRRRPTPRRSLITGGRRRKAGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.29
3 0.23
4 0.13
5 0.07
6 0.06
7 0.06
8 0.06
9 0.07
10 0.07
11 0.08
12 0.09
13 0.11
14 0.15
15 0.18
16 0.24
17 0.24
18 0.26
19 0.27
20 0.31
21 0.3
22 0.29
23 0.28
24 0.23
25 0.23
26 0.22
27 0.26
28 0.22
29 0.27
30 0.28
31 0.32
32 0.39
33 0.47
34 0.55
35 0.6
36 0.69
37 0.73
38 0.78
39 0.8
40 0.78
41 0.8
42 0.74
43 0.71
44 0.63
45 0.57
46 0.5
47 0.41
48 0.34
49 0.25
50 0.21
51 0.14
52 0.11
53 0.07
54 0.08
55 0.09
56 0.1
57 0.11
58 0.12
59 0.13
60 0.14
61 0.14
62 0.13
63 0.14
64 0.14
65 0.14
66 0.12
67 0.11
68 0.11
69 0.1
70 0.09
71 0.06
72 0.05
73 0.05
74 0.04
75 0.04
76 0.03
77 0.03
78 0.04
79 0.08
80 0.08
81 0.08
82 0.09
83 0.11
84 0.12
85 0.13
86 0.14
87 0.09
88 0.1
89 0.11
90 0.11
91 0.09
92 0.09
93 0.1
94 0.15
95 0.17
96 0.17
97 0.19
98 0.19
99 0.2
100 0.22
101 0.25
102 0.21
103 0.22
104 0.25
105 0.23
106 0.22
107 0.23
108 0.22
109 0.19
110 0.18
111 0.17
112 0.17
113 0.22
114 0.22
115 0.21
116 0.25
117 0.25
118 0.26
119 0.28
120 0.29
121 0.27
122 0.27
123 0.27
124 0.22
125 0.23
126 0.25
127 0.25
128 0.25
129 0.22
130 0.23
131 0.25
132 0.27
133 0.26
134 0.24
135 0.2
136 0.17
137 0.18
138 0.16
139 0.13
140 0.1
141 0.09
142 0.07
143 0.07
144 0.04
145 0.03
146 0.04
147 0.08
148 0.12
149 0.14
150 0.22
151 0.3
152 0.32
153 0.36
154 0.44
155 0.51
156 0.57
157 0.6
158 0.56
159 0.56
160 0.57
161 0.57
162 0.48
163 0.39
164 0.32
165 0.28
166 0.24
167 0.16
168 0.13
169 0.1
170 0.09
171 0.07
172 0.04
173 0.03
174 0.03
175 0.03
176 0.03
177 0.03
178 0.04
179 0.04
180 0.05
181 0.05
182 0.06
183 0.06
184 0.07
185 0.08
186 0.07
187 0.07
188 0.08
189 0.09
190 0.13
191 0.17
192 0.18
193 0.24
194 0.29
195 0.39
196 0.49
197 0.57
198 0.63
199 0.7
200 0.78
201 0.79
202 0.8
203 0.79
204 0.78
205 0.79
206 0.8
207 0.79
208 0.75