Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5YS01

Protein Details
Accession A0A2C5YS01   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
9-39ATTATMVKKRKNNGRNKKGRGHVKPIRCSNCHydrophilic
94-125GKIVRVRSRVGRRNRAPPPRVRYNKDGKKITPBasic
NLS Segment(s)
PositionSequence
16-32KKRKNNGRNKKGRGHVK
98-129RVRSRVGRRNRAPPPRVRYNKDGKKITPTAPK
Subcellular Location(s) mito 11, nucl 10, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MLSRQHRFATTATMVKKRKNNGRNKKGRGHVKPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISDASVFSEYTVPKMYLKLQYCVSCAIHGKIVRVRSRVGRRNRAPPPRVRYNKDGKKITPTAPKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.52
3 0.58
4 0.59
5 0.65
6 0.68
7 0.74
8 0.76
9 0.83
10 0.87
11 0.88
12 0.88
13 0.86
14 0.87
15 0.84
16 0.83
17 0.8
18 0.79
19 0.8
20 0.8
21 0.77
22 0.69
23 0.69
24 0.66
25 0.66
26 0.65
27 0.63
28 0.6
29 0.61
30 0.64
31 0.66
32 0.68
33 0.67
34 0.69
35 0.7
36 0.72
37 0.68
38 0.69
39 0.64
40 0.64
41 0.56
42 0.48
43 0.42
44 0.34
45 0.31
46 0.25
47 0.22
48 0.13
49 0.12
50 0.1
51 0.08
52 0.08
53 0.07
54 0.06
55 0.05
56 0.05
57 0.06
58 0.06
59 0.06
60 0.08
61 0.08
62 0.09
63 0.1
64 0.1
65 0.1
66 0.12
67 0.14
68 0.19
69 0.22
70 0.23
71 0.26
72 0.26
73 0.27
74 0.29
75 0.26
76 0.21
77 0.21
78 0.2
79 0.21
80 0.21
81 0.23
82 0.24
83 0.3
84 0.33
85 0.33
86 0.35
87 0.4
88 0.49
89 0.54
90 0.61
91 0.65
92 0.67
93 0.75
94 0.82
95 0.83
96 0.8
97 0.81
98 0.79
99 0.8
100 0.82
101 0.79
102 0.78
103 0.79
104 0.81
105 0.81
106 0.8
107 0.73
108 0.73
109 0.72
110 0.71