Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C6A3T4

Protein Details
Accession A0A2C6A3T4    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
14-34ETPGRGRAKSQQPKARPTDQPHydrophilic
74-98PPTLRRDKEGKQRRAQRRTENCHDGBasic
NLS Segment(s)
PositionSequence
79-88RDKEGKQRRA
Subcellular Location(s) nucl 12, mito 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MSGKLTPARPSGAETPGRGRAKSQQPKARPTDQPRVSDGGHALAPPPPAGPGRRTCPRAEAGRPRHASTTTHLPPTLRRDKEGKQRRAQRRTENCHDGQKARGLCRQHPRPRTGPSKPAPRPELPRDVTAPPPANAILSLCLYLGRRPTGGERGPRNRCDRLRRPAATDKSSRHCCGFAAAAAVLCRCAPERPGSSPAQPRPRLFSFSRGIAAAEGSRAVADRAEAAAGRRRLSAGPGSAALFFFESQVVRSSFMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.46
4 0.48
5 0.43
6 0.41
7 0.44
8 0.51
9 0.58
10 0.63
11 0.63
12 0.68
13 0.77
14 0.81
15 0.8
16 0.79
17 0.77
18 0.78
19 0.75
20 0.71
21 0.66
22 0.62
23 0.54
24 0.47
25 0.4
26 0.31
27 0.25
28 0.21
29 0.18
30 0.16
31 0.16
32 0.13
33 0.12
34 0.12
35 0.14
36 0.17
37 0.22
38 0.25
39 0.32
40 0.4
41 0.43
42 0.43
43 0.45
44 0.48
45 0.49
46 0.52
47 0.56
48 0.55
49 0.62
50 0.64
51 0.61
52 0.58
53 0.52
54 0.45
55 0.39
56 0.42
57 0.35
58 0.35
59 0.34
60 0.32
61 0.35
62 0.42
63 0.47
64 0.38
65 0.38
66 0.41
67 0.48
68 0.58
69 0.64
70 0.64
71 0.64
72 0.73
73 0.8
74 0.83
75 0.84
76 0.84
77 0.83
78 0.83
79 0.82
80 0.8
81 0.72
82 0.7
83 0.66
84 0.56
85 0.48
86 0.45
87 0.4
88 0.35
89 0.36
90 0.32
91 0.36
92 0.44
93 0.52
94 0.55
95 0.58
96 0.61
97 0.63
98 0.67
99 0.69
100 0.64
101 0.62
102 0.6
103 0.64
104 0.63
105 0.64
106 0.62
107 0.57
108 0.59
109 0.55
110 0.57
111 0.48
112 0.46
113 0.42
114 0.39
115 0.36
116 0.33
117 0.3
118 0.21
119 0.2
120 0.18
121 0.15
122 0.13
123 0.11
124 0.08
125 0.07
126 0.07
127 0.05
128 0.07
129 0.07
130 0.08
131 0.1
132 0.1
133 0.1
134 0.11
135 0.13
136 0.19
137 0.22
138 0.28
139 0.34
140 0.43
141 0.49
142 0.54
143 0.57
144 0.59
145 0.62
146 0.65
147 0.66
148 0.66
149 0.7
150 0.66
151 0.67
152 0.69
153 0.69
154 0.65
155 0.62
156 0.58
157 0.56
158 0.6
159 0.55
160 0.47
161 0.41
162 0.35
163 0.32
164 0.27
165 0.19
166 0.15
167 0.13
168 0.12
169 0.12
170 0.12
171 0.09
172 0.08
173 0.08
174 0.07
175 0.08
176 0.1
177 0.16
178 0.2
179 0.24
180 0.29
181 0.32
182 0.38
183 0.46
184 0.52
185 0.56
186 0.58
187 0.55
188 0.57
189 0.58
190 0.57
191 0.5
192 0.49
193 0.42
194 0.39
195 0.39
196 0.32
197 0.3
198 0.24
199 0.23
200 0.16
201 0.12
202 0.1
203 0.08
204 0.08
205 0.08
206 0.08
207 0.06
208 0.06
209 0.07
210 0.07
211 0.08
212 0.09
213 0.11
214 0.19
215 0.21
216 0.22
217 0.22
218 0.24
219 0.24
220 0.27
221 0.3
222 0.25
223 0.25
224 0.25
225 0.25
226 0.24
227 0.24
228 0.21
229 0.16
230 0.14
231 0.12
232 0.12
233 0.11
234 0.11
235 0.15
236 0.16