Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C6A2T2

Protein Details
Accession A0A2C6A2T2   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
80-100VEKDQRADRRRNASSKRNREPBasic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 10.5, cyto 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008949  Isoprenoid_synthase_dom_sf  
Pfam View protein in Pfam  
PF19086  Terpene_syn_C_2  
CDD cd00385  Isoprenoid_Biosyn_C1  
Amino Acid Sequences MIRTLREYLESCDTPKDEFDRMDEYVHYRFESSGYLVAAFFIRWGMGITIADQEYESIREYEMAMGNVFGLTNDYFSWNVEKDQRADRRRNASSKRNREP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.29
4 0.24
5 0.24
6 0.25
7 0.25
8 0.25
9 0.25
10 0.23
11 0.23
12 0.22
13 0.22
14 0.2
15 0.16
16 0.15
17 0.14
18 0.15
19 0.12
20 0.11
21 0.1
22 0.1
23 0.09
24 0.1
25 0.09
26 0.07
27 0.06
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.05
36 0.06
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.07
43 0.07
44 0.06
45 0.06
46 0.07
47 0.07
48 0.09
49 0.1
50 0.09
51 0.08
52 0.08
53 0.08
54 0.07
55 0.07
56 0.05
57 0.06
58 0.05
59 0.06
60 0.06
61 0.09
62 0.09
63 0.1
64 0.13
65 0.13
66 0.16
67 0.2
68 0.23
69 0.25
70 0.34
71 0.43
72 0.48
73 0.56
74 0.61
75 0.65
76 0.71
77 0.77
78 0.77
79 0.78
80 0.81