Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5Z7Q8

Protein Details
Accession A0A2C5Z7Q8   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-24DDHRIDPKRRHVVDHRKRQFBasic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007238  DNA_primase_lsu_euk/arc  
Gene Ontology GO:0051539  F:4 iron, 4 sulfur cluster binding  
GO:0046872  F:metal ion binding  
GO:0006269  P:DNA replication, synthesis of RNA primer  
Amino Acid Sequences MLRHDDHRIDPKRRHVVDHRKRQFATPQYKDAEYPHRLNLYSDAPTADITLEQFEQWAIDRLRVLAELEACSYRNKTAAETAAHMKPVLDKFLPLETNSSGSSRLAAQRQKDHYSHFILRLAFASTEDLRRRFGRFETMLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.72
3 0.74
4 0.76
5 0.8
6 0.79
7 0.76
8 0.76
9 0.72
10 0.71
11 0.69
12 0.69
13 0.63
14 0.62
15 0.57
16 0.57
17 0.53
18 0.49
19 0.47
20 0.42
21 0.39
22 0.37
23 0.36
24 0.35
25 0.35
26 0.34
27 0.28
28 0.24
29 0.22
30 0.18
31 0.16
32 0.16
33 0.15
34 0.11
35 0.08
36 0.07
37 0.07
38 0.07
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.11
45 0.1
46 0.11
47 0.11
48 0.11
49 0.12
50 0.12
51 0.11
52 0.07
53 0.07
54 0.07
55 0.08
56 0.08
57 0.08
58 0.09
59 0.09
60 0.09
61 0.1
62 0.1
63 0.11
64 0.13
65 0.15
66 0.15
67 0.17
68 0.2
69 0.19
70 0.19
71 0.18
72 0.15
73 0.16
74 0.16
75 0.17
76 0.13
77 0.13
78 0.14
79 0.18
80 0.19
81 0.15
82 0.17
83 0.15
84 0.17
85 0.17
86 0.16
87 0.14
88 0.13
89 0.13
90 0.13
91 0.16
92 0.21
93 0.25
94 0.29
95 0.37
96 0.43
97 0.47
98 0.47
99 0.48
100 0.47
101 0.49
102 0.48
103 0.43
104 0.41
105 0.35
106 0.34
107 0.3
108 0.27
109 0.2
110 0.17
111 0.19
112 0.17
113 0.23
114 0.28
115 0.29
116 0.31
117 0.34
118 0.36
119 0.35
120 0.36
121 0.39