Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5YX03

Protein Details
Accession A0A2C5YX03    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
106-125ETPKVKGKRGRPSKKSLEAQBasic
NLS Segment(s)
PositionSequence
31-120KSYVPTGRPRGRPKSDNPKAKSYVPTGRPRGRPKGSGKKKSAGGGVAPAATAASSTPKAASGTGKRGRPRKSDAGETPKVKGKRGRPSKK
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MARTKEDATGESTPRGRGRPSLGSAGDGVKKSYVPTGRPRGRPKSDNPKAKSYVPTGRPRGRPKGSGKKKSAGGGVAPAATAASSTPKAASGTGKRGRPRKSDAGETPKVKGKRGRPSKKSLEAQDVADAADLDADADAEPLSDHMDDVADHAMDQDNLAVESGEESDLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.34
4 0.33
5 0.37
6 0.39
7 0.41
8 0.43
9 0.4
10 0.38
11 0.37
12 0.36
13 0.34
14 0.27
15 0.24
16 0.18
17 0.18
18 0.17
19 0.22
20 0.23
21 0.24
22 0.33
23 0.43
24 0.5
25 0.59
26 0.67
27 0.7
28 0.74
29 0.76
30 0.76
31 0.76
32 0.78
33 0.79
34 0.75
35 0.73
36 0.69
37 0.67
38 0.61
39 0.56
40 0.55
41 0.53
42 0.57
43 0.57
44 0.61
45 0.66
46 0.69
47 0.72
48 0.68
49 0.68
50 0.69
51 0.72
52 0.74
53 0.75
54 0.73
55 0.69
56 0.67
57 0.62
58 0.54
59 0.44
60 0.34
61 0.26
62 0.22
63 0.16
64 0.13
65 0.1
66 0.07
67 0.06
68 0.05
69 0.03
70 0.04
71 0.05
72 0.05
73 0.05
74 0.06
75 0.07
76 0.08
77 0.12
78 0.13
79 0.22
80 0.27
81 0.32
82 0.37
83 0.43
84 0.49
85 0.5
86 0.54
87 0.54
88 0.53
89 0.56
90 0.58
91 0.6
92 0.61
93 0.57
94 0.53
95 0.51
96 0.48
97 0.45
98 0.44
99 0.44
100 0.48
101 0.57
102 0.65
103 0.66
104 0.74
105 0.78
106 0.81
107 0.79
108 0.73
109 0.7
110 0.62
111 0.56
112 0.49
113 0.4
114 0.3
115 0.24
116 0.19
117 0.1
118 0.08
119 0.06
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.06
130 0.06
131 0.06
132 0.06
133 0.06
134 0.06
135 0.08
136 0.09
137 0.08
138 0.08
139 0.09
140 0.1
141 0.09
142 0.1
143 0.09
144 0.08
145 0.08
146 0.09
147 0.08
148 0.06
149 0.07
150 0.08