Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5ZRD3

Protein Details
Accession A0A2C5ZRD3   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
46-66SANGRRRGKRRIMTKKRILDDBasic
NLS Segment(s)
PositionSequence
49-62GRRRGKRRIMTKKR
Subcellular Location(s) nucl 14.5, cyto_nucl 10.833, cyto 6, cyto_pero 5.333, pero 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019038  POLD3  
Gene Ontology GO:0043625  C:delta DNA polymerase complex  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF09507  CDC27  
Amino Acid Sequences MNDDEPDDEEMEEAPEPEPEPEPEPETADNWGAKTEDEPTEVISTSANGRRRGKRRIMTKKRILDDQGYMVTIQEPAWEYFSEDEAPQPAAKKPTPTSTPSSSGARAKKPGSKSGQGNIMSFFSRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.11
5 0.13
6 0.13
7 0.16
8 0.18
9 0.2
10 0.2
11 0.22
12 0.22
13 0.21
14 0.21
15 0.2
16 0.18
17 0.16
18 0.16
19 0.13
20 0.12
21 0.12
22 0.14
23 0.12
24 0.13
25 0.13
26 0.13
27 0.14
28 0.14
29 0.13
30 0.1
31 0.09
32 0.11
33 0.16
34 0.2
35 0.25
36 0.32
37 0.4
38 0.47
39 0.54
40 0.6
41 0.62
42 0.68
43 0.74
44 0.78
45 0.79
46 0.82
47 0.81
48 0.74
49 0.7
50 0.61
51 0.52
52 0.43
53 0.35
54 0.26
55 0.19
56 0.17
57 0.13
58 0.11
59 0.09
60 0.07
61 0.06
62 0.07
63 0.07
64 0.09
65 0.09
66 0.1
67 0.1
68 0.11
69 0.12
70 0.1
71 0.1
72 0.1
73 0.11
74 0.11
75 0.12
76 0.14
77 0.18
78 0.19
79 0.24
80 0.26
81 0.32
82 0.36
83 0.39
84 0.42
85 0.42
86 0.45
87 0.43
88 0.44
89 0.41
90 0.44
91 0.45
92 0.44
93 0.45
94 0.46
95 0.49
96 0.51
97 0.56
98 0.56
99 0.58
100 0.58
101 0.58
102 0.62
103 0.57
104 0.53
105 0.47
106 0.41