Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C6AHX0

Protein Details
Accession A0A2C6AHX0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
64-84ETQRRRCETRASRREEKRHPWBasic
NLS Segment(s)
Subcellular Location(s) mito 15, extr 8, mito_nucl 8
Family & Domain DBs
Amino Acid Sequences MSIRPLAIGLPSLGAHLARIGTSAVNRVDVTPWRGCDDALPKLFYPCAMRASPAVPWRQCGAVETQRRRCETRASRREEKRHPWLPSPPAALTLDPAFRGGHVVAGSGIICLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.08
5 0.06
6 0.07
7 0.07
8 0.08
9 0.08
10 0.12
11 0.12
12 0.13
13 0.14
14 0.14
15 0.16
16 0.18
17 0.22
18 0.21
19 0.22
20 0.23
21 0.23
22 0.22
23 0.23
24 0.25
25 0.26
26 0.26
27 0.26
28 0.24
29 0.25
30 0.25
31 0.22
32 0.2
33 0.15
34 0.17
35 0.15
36 0.16
37 0.16
38 0.17
39 0.19
40 0.2
41 0.23
42 0.2
43 0.21
44 0.21
45 0.21
46 0.2
47 0.17
48 0.19
49 0.22
50 0.3
51 0.37
52 0.44
53 0.48
54 0.51
55 0.53
56 0.49
57 0.51
58 0.53
59 0.57
60 0.58
61 0.62
62 0.69
63 0.75
64 0.83
65 0.81
66 0.8
67 0.78
68 0.78
69 0.74
70 0.7
71 0.69
72 0.65
73 0.62
74 0.57
75 0.48
76 0.42
77 0.39
78 0.33
79 0.27
80 0.25
81 0.2
82 0.16
83 0.17
84 0.14
85 0.12
86 0.15
87 0.12
88 0.13
89 0.11
90 0.12
91 0.1
92 0.11
93 0.11