Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5ZGM1

Protein Details
Accession A0A2C5ZGM1    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MVPRLRRRPLHGTKLQRLPRRMBasic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 6, nucl 3, cyto_pero 3
Family & Domain DBs
Amino Acid Sequences MVPRLRRRPLHGTKLQRLPRRMEPPGQHHDLQAGEIGRWFWRATGPSNFLPEHGVGGETHRSFQLTDFYGNGEQTGANMEVMRPAAPVTRCSAATAAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.81
4 0.76
5 0.72
6 0.72
7 0.7
8 0.66
9 0.64
10 0.63
11 0.62
12 0.65
13 0.64
14 0.55
15 0.46
16 0.44
17 0.36
18 0.29
19 0.23
20 0.16
21 0.11
22 0.11
23 0.11
24 0.09
25 0.1
26 0.1
27 0.07
28 0.09
29 0.11
30 0.14
31 0.18
32 0.22
33 0.22
34 0.25
35 0.25
36 0.23
37 0.22
38 0.18
39 0.14
40 0.1
41 0.1
42 0.06
43 0.09
44 0.12
45 0.11
46 0.12
47 0.11
48 0.12
49 0.12
50 0.13
51 0.15
52 0.13
53 0.14
54 0.13
55 0.16
56 0.16
57 0.16
58 0.15
59 0.11
60 0.09
61 0.08
62 0.11
63 0.09
64 0.08
65 0.08
66 0.08
67 0.1
68 0.11
69 0.11
70 0.08
71 0.08
72 0.13
73 0.15
74 0.17
75 0.2
76 0.22
77 0.23
78 0.25