Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C6AGJ3

Protein Details
Accession A0A2C6AGJ3   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
136-157EPMPHAWTRTRRRARARVSTAVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 8.5, cyto_nucl 6, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MCPSLRSAGPGACTHLPTWRSLPSSAHPSRQAVEEEEINPIRRSGQRVVTRSVTAPCGATGQGMPAWVPLQRSLARTGTSVAADLSTNPASQPITACPSHPPSRAAANEGSARSHSVDERKRRRSEQLQRAQTGCEPMPHAWTRTRRRARARVSTAVAGCFGTPILRVSQGKALAIEPRCGDCESRVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.3
3 0.28
4 0.28
5 0.3
6 0.3
7 0.31
8 0.31
9 0.34
10 0.33
11 0.42
12 0.42
13 0.45
14 0.43
15 0.42
16 0.42
17 0.41
18 0.38
19 0.31
20 0.3
21 0.27
22 0.24
23 0.27
24 0.28
25 0.27
26 0.25
27 0.22
28 0.23
29 0.23
30 0.27
31 0.26
32 0.34
33 0.39
34 0.42
35 0.47
36 0.46
37 0.45
38 0.41
39 0.38
40 0.31
41 0.23
42 0.2
43 0.16
44 0.14
45 0.12
46 0.11
47 0.09
48 0.09
49 0.08
50 0.08
51 0.07
52 0.07
53 0.07
54 0.08
55 0.09
56 0.08
57 0.12
58 0.14
59 0.16
60 0.18
61 0.19
62 0.19
63 0.19
64 0.19
65 0.16
66 0.14
67 0.13
68 0.1
69 0.08
70 0.07
71 0.07
72 0.08
73 0.08
74 0.08
75 0.07
76 0.08
77 0.08
78 0.08
79 0.09
80 0.07
81 0.11
82 0.11
83 0.12
84 0.14
85 0.19
86 0.23
87 0.24
88 0.24
89 0.22
90 0.27
91 0.27
92 0.27
93 0.22
94 0.2
95 0.22
96 0.21
97 0.2
98 0.15
99 0.15
100 0.14
101 0.14
102 0.14
103 0.19
104 0.27
105 0.36
106 0.46
107 0.53
108 0.58
109 0.61
110 0.67
111 0.7
112 0.73
113 0.74
114 0.74
115 0.74
116 0.72
117 0.69
118 0.61
119 0.52
120 0.46
121 0.35
122 0.27
123 0.22
124 0.19
125 0.25
126 0.25
127 0.26
128 0.28
129 0.37
130 0.44
131 0.52
132 0.61
133 0.64
134 0.72
135 0.8
136 0.82
137 0.83
138 0.81
139 0.78
140 0.72
141 0.69
142 0.6
143 0.51
144 0.43
145 0.32
146 0.25
147 0.17
148 0.13
149 0.08
150 0.08
151 0.08
152 0.09
153 0.15
154 0.16
155 0.18
156 0.24
157 0.25
158 0.25
159 0.25
160 0.25
161 0.27
162 0.28
163 0.29
164 0.26
165 0.26
166 0.28
167 0.28
168 0.29