Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8MTU0

Protein Details
Accession B8MTU0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
22-41VFPKMRSRFCRPKKLSNALLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 2, plas 2
Family & Domain DBs
Amino Acid Sequences MRRYLVAGLAATTVWSGLSYVVFPKMRSRFCRPKKLSNALLVPAEDKTRRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.04
5 0.04
6 0.05
7 0.06
8 0.1
9 0.11
10 0.12
11 0.19
12 0.24
13 0.29
14 0.34
15 0.43
16 0.49
17 0.57
18 0.68
19 0.67
20 0.73
21 0.77
22 0.8
23 0.76
24 0.73
25 0.68
26 0.6
27 0.56
28 0.46
29 0.37
30 0.3
31 0.3