Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5ZKI2

Protein Details
Accession A0A2C5ZKI2    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
33-62KRAPGRKLYHHSRRRAQKRKQALQPPQPPABasic
NLS Segment(s)
PositionSequence
30-53PSAKRAPGRKLYHHSRRRAQKRKQ
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MSHLPNTSPFSRETPTARLPDQREKQADGPSAKRAPGRKLYHHSRRRAQKRKQALQPPQPPASVPTGPGSGAAEVEPPPRARTRTGTPSATPIGHRIHTRPSAQPLPPPSKGRSTNHGLDSRAGPPAQSQH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.39
3 0.41
4 0.42
5 0.45
6 0.49
7 0.55
8 0.57
9 0.59
10 0.56
11 0.56
12 0.57
13 0.56
14 0.56
15 0.5
16 0.47
17 0.45
18 0.44
19 0.42
20 0.42
21 0.4
22 0.4
23 0.45
24 0.48
25 0.49
26 0.55
27 0.63
28 0.7
29 0.74
30 0.75
31 0.74
32 0.79
33 0.82
34 0.84
35 0.84
36 0.83
37 0.85
38 0.86
39 0.86
40 0.85
41 0.84
42 0.84
43 0.82
44 0.78
45 0.69
46 0.6
47 0.51
48 0.43
49 0.38
50 0.28
51 0.21
52 0.16
53 0.15
54 0.14
55 0.14
56 0.13
57 0.08
58 0.08
59 0.06
60 0.06
61 0.06
62 0.07
63 0.09
64 0.09
65 0.11
66 0.14
67 0.16
68 0.17
69 0.22
70 0.28
71 0.34
72 0.39
73 0.4
74 0.38
75 0.41
76 0.41
77 0.37
78 0.31
79 0.26
80 0.24
81 0.24
82 0.25
83 0.23
84 0.28
85 0.32
86 0.35
87 0.35
88 0.4
89 0.43
90 0.43
91 0.47
92 0.48
93 0.5
94 0.53
95 0.53
96 0.49
97 0.51
98 0.57
99 0.55
100 0.54
101 0.54
102 0.55
103 0.58
104 0.59
105 0.52
106 0.48
107 0.47
108 0.42
109 0.39
110 0.32
111 0.25