Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5ZI52

Protein Details
Accession A0A2C5ZI52    Localization Confidence High Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
317-339SQQGGEKEWNGKKKNKKRDSPRRBasic
NLS Segment(s)
PositionSequence
62-90ERRRRTSLRGKTTEGGRKGGGRGRRPGKS
211-221KRARSGIGRGR
326-339NGKKKNKKRDSPRR
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 2
Family & Domain DBs
Amino Acid Sequences MDPSADDVESRRGTPGPEPWNTLLQQGPPSALDDKNVRNQRKAWGGAARGGPGGGGASSGCERRRRTSLRGKTTEGGRKGGGRGRRPGKSVEAQRAGPAAEAWARTEQRRVAAHEDRGAQARHVAMLFFLGPPLGCCPSSAGPLLLLLDALAPLAAADSAGSCSCLGDDERAACRLRLRNRPTSAPSAIISPAAHVVVRPDGRRTYRIDAKRARSGIGRGRGHDGVHGRSAAGPARNGGDRGPCSSPSSSGPSRQPACFPLPALPRVQGFIETATTIRELVRTPDPEAAFSRETVSPRPRNRLARPTPAGQEIKQDSQQGGEKEWNGKKKNKKRDSPRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.35
3 0.35
4 0.37
5 0.43
6 0.43
7 0.47
8 0.45
9 0.43
10 0.37
11 0.33
12 0.33
13 0.28
14 0.26
15 0.21
16 0.24
17 0.25
18 0.22
19 0.23
20 0.25
21 0.29
22 0.38
23 0.47
24 0.48
25 0.49
26 0.52
27 0.56
28 0.58
29 0.56
30 0.52
31 0.5
32 0.48
33 0.49
34 0.48
35 0.41
36 0.32
37 0.29
38 0.23
39 0.16
40 0.14
41 0.07
42 0.06
43 0.04
44 0.06
45 0.08
46 0.12
47 0.16
48 0.23
49 0.26
50 0.32
51 0.42
52 0.46
53 0.53
54 0.61
55 0.68
56 0.71
57 0.74
58 0.73
59 0.69
60 0.71
61 0.7
62 0.62
63 0.54
64 0.45
65 0.42
66 0.41
67 0.41
68 0.4
69 0.38
70 0.45
71 0.49
72 0.52
73 0.52
74 0.52
75 0.53
76 0.54
77 0.55
78 0.55
79 0.52
80 0.48
81 0.46
82 0.44
83 0.37
84 0.29
85 0.21
86 0.13
87 0.11
88 0.11
89 0.12
90 0.16
91 0.17
92 0.18
93 0.22
94 0.22
95 0.25
96 0.27
97 0.29
98 0.32
99 0.36
100 0.38
101 0.38
102 0.38
103 0.34
104 0.35
105 0.32
106 0.24
107 0.2
108 0.18
109 0.14
110 0.13
111 0.11
112 0.08
113 0.08
114 0.08
115 0.06
116 0.06
117 0.05
118 0.04
119 0.05
120 0.07
121 0.08
122 0.08
123 0.08
124 0.11
125 0.12
126 0.14
127 0.14
128 0.12
129 0.11
130 0.11
131 0.11
132 0.08
133 0.06
134 0.04
135 0.04
136 0.03
137 0.03
138 0.03
139 0.02
140 0.02
141 0.02
142 0.02
143 0.02
144 0.02
145 0.02
146 0.03
147 0.03
148 0.04
149 0.04
150 0.04
151 0.04
152 0.05
153 0.05
154 0.06
155 0.06
156 0.08
157 0.09
158 0.12
159 0.12
160 0.12
161 0.15
162 0.21
163 0.28
164 0.36
165 0.41
166 0.47
167 0.5
168 0.54
169 0.54
170 0.53
171 0.47
172 0.39
173 0.34
174 0.26
175 0.24
176 0.2
177 0.16
178 0.1
179 0.1
180 0.08
181 0.08
182 0.06
183 0.07
184 0.1
185 0.13
186 0.13
187 0.15
188 0.2
189 0.23
190 0.26
191 0.3
192 0.32
193 0.39
194 0.43
195 0.5
196 0.53
197 0.56
198 0.6
199 0.56
200 0.51
201 0.44
202 0.45
203 0.43
204 0.45
205 0.41
206 0.36
207 0.4
208 0.39
209 0.37
210 0.35
211 0.31
212 0.24
213 0.23
214 0.22
215 0.17
216 0.17
217 0.18
218 0.17
219 0.15
220 0.13
221 0.13
222 0.15
223 0.16
224 0.16
225 0.16
226 0.18
227 0.18
228 0.22
229 0.23
230 0.22
231 0.25
232 0.26
233 0.26
234 0.24
235 0.3
236 0.28
237 0.31
238 0.34
239 0.39
240 0.41
241 0.41
242 0.4
243 0.37
244 0.39
245 0.35
246 0.32
247 0.31
248 0.32
249 0.33
250 0.32
251 0.31
252 0.27
253 0.26
254 0.26
255 0.2
256 0.16
257 0.15
258 0.14
259 0.12
260 0.12
261 0.11
262 0.11
263 0.1
264 0.1
265 0.1
266 0.1
267 0.14
268 0.2
269 0.22
270 0.24
271 0.3
272 0.3
273 0.31
274 0.33
275 0.34
276 0.28
277 0.26
278 0.28
279 0.24
280 0.26
281 0.31
282 0.38
283 0.43
284 0.49
285 0.57
286 0.62
287 0.68
288 0.75
289 0.78
290 0.77
291 0.78
292 0.76
293 0.73
294 0.69
295 0.68
296 0.63
297 0.53
298 0.54
299 0.49
300 0.49
301 0.47
302 0.45
303 0.37
304 0.37
305 0.42
306 0.35
307 0.33
308 0.33
309 0.33
310 0.4
311 0.47
312 0.52
313 0.53
314 0.61
315 0.68
316 0.73
317 0.81
318 0.83
319 0.86