Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C6A0S5

Protein Details
Accession A0A2C6A0S5   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
371-395LGGFTKPGKRTSKKTKAQTGLQQLDHydrophilic
NLS Segment(s)
PositionSequence
294-299RRKRRK
Subcellular Location(s) nucl 15.5, cyto_nucl 11, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007307  Ltv1  
Gene Ontology GO:0042274  P:ribosomal small subunit biogenesis  
Pfam View protein in Pfam  
PF04180  LTV  
Amino Acid Sequences MPRGKWIDKKTAQHFTLVHRPQNDPLIHDEDAPSMVLNPTRTTAGPSKVKHLDDLASELGSDAASIRANEGEAASYGVYFDDTEYDYMQHLRDLNSGGGEVVFIEADPKGKRGKQKESLDEALRRLDLEQKSGEVLDEEILPSKNLTRVTYESQQNVPDSIRGFQPDMDPRLREVLEALEDDAYVEDEDDVFQELAKDGRELDDLEFEETNQDEAYDDDDGWESEDTAKPIKEYRDEVPELVRSADEQPEHGPSQDWLEDFKQFKKEQTTGRAPAAPSQSEMRSTWTTTTNGGRRKRRKGALTDASSYSMTSSSLVRTEQMTLLDARFDKLEEKYNEDVEDEMASVSAASAASSVTGPTRGDFDGILDDFLGGFTKPGKRTSKKTKAQTGLQQLDEIRRELGPARIPGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.6
3 0.63
4 0.6
5 0.57
6 0.51
7 0.53
8 0.51
9 0.57
10 0.5
11 0.42
12 0.41
13 0.41
14 0.38
15 0.36
16 0.32
17 0.25
18 0.24
19 0.22
20 0.16
21 0.11
22 0.12
23 0.14
24 0.15
25 0.15
26 0.16
27 0.18
28 0.18
29 0.23
30 0.27
31 0.33
32 0.39
33 0.4
34 0.46
35 0.51
36 0.52
37 0.48
38 0.45
39 0.39
40 0.32
41 0.35
42 0.28
43 0.21
44 0.19
45 0.17
46 0.14
47 0.11
48 0.1
49 0.06
50 0.06
51 0.07
52 0.07
53 0.08
54 0.08
55 0.09
56 0.09
57 0.09
58 0.09
59 0.08
60 0.09
61 0.08
62 0.07
63 0.07
64 0.07
65 0.07
66 0.06
67 0.06
68 0.07
69 0.08
70 0.09
71 0.1
72 0.1
73 0.11
74 0.12
75 0.12
76 0.13
77 0.14
78 0.14
79 0.15
80 0.17
81 0.16
82 0.15
83 0.15
84 0.13
85 0.11
86 0.09
87 0.07
88 0.05
89 0.04
90 0.04
91 0.05
92 0.05
93 0.08
94 0.09
95 0.11
96 0.16
97 0.2
98 0.29
99 0.37
100 0.46
101 0.53
102 0.61
103 0.67
104 0.7
105 0.72
106 0.69
107 0.64
108 0.56
109 0.48
110 0.39
111 0.31
112 0.24
113 0.26
114 0.21
115 0.21
116 0.2
117 0.18
118 0.19
119 0.18
120 0.18
121 0.1
122 0.1
123 0.07
124 0.07
125 0.07
126 0.08
127 0.08
128 0.08
129 0.08
130 0.09
131 0.12
132 0.13
133 0.14
134 0.16
135 0.19
136 0.24
137 0.31
138 0.34
139 0.33
140 0.34
141 0.35
142 0.31
143 0.29
144 0.24
145 0.19
146 0.16
147 0.15
148 0.14
149 0.14
150 0.14
151 0.13
152 0.18
153 0.2
154 0.24
155 0.24
156 0.24
157 0.23
158 0.26
159 0.25
160 0.2
161 0.16
162 0.13
163 0.11
164 0.11
165 0.11
166 0.07
167 0.07
168 0.07
169 0.06
170 0.06
171 0.04
172 0.04
173 0.04
174 0.03
175 0.04
176 0.04
177 0.05
178 0.04
179 0.04
180 0.05
181 0.05
182 0.06
183 0.06
184 0.06
185 0.05
186 0.06
187 0.07
188 0.08
189 0.08
190 0.09
191 0.09
192 0.11
193 0.1
194 0.09
195 0.09
196 0.09
197 0.08
198 0.06
199 0.06
200 0.04
201 0.05
202 0.06
203 0.06
204 0.05
205 0.06
206 0.06
207 0.06
208 0.07
209 0.07
210 0.06
211 0.07
212 0.08
213 0.08
214 0.1
215 0.1
216 0.1
217 0.13
218 0.15
219 0.17
220 0.19
221 0.21
222 0.26
223 0.27
224 0.27
225 0.26
226 0.25
227 0.23
228 0.2
229 0.17
230 0.12
231 0.12
232 0.15
233 0.13
234 0.12
235 0.13
236 0.16
237 0.17
238 0.16
239 0.14
240 0.12
241 0.15
242 0.15
243 0.14
244 0.13
245 0.14
246 0.19
247 0.21
248 0.24
249 0.27
250 0.27
251 0.3
252 0.34
253 0.38
254 0.39
255 0.46
256 0.5
257 0.47
258 0.49
259 0.49
260 0.42
261 0.43
262 0.4
263 0.32
264 0.26
265 0.26
266 0.24
267 0.23
268 0.23
269 0.23
270 0.21
271 0.22
272 0.22
273 0.22
274 0.22
275 0.23
276 0.3
277 0.31
278 0.38
279 0.45
280 0.53
281 0.6
282 0.69
283 0.75
284 0.76
285 0.77
286 0.77
287 0.79
288 0.79
289 0.74
290 0.68
291 0.6
292 0.54
293 0.46
294 0.38
295 0.28
296 0.18
297 0.13
298 0.1
299 0.1
300 0.09
301 0.1
302 0.11
303 0.11
304 0.12
305 0.14
306 0.15
307 0.14
308 0.15
309 0.15
310 0.14
311 0.17
312 0.16
313 0.15
314 0.14
315 0.14
316 0.15
317 0.16
318 0.25
319 0.24
320 0.3
321 0.32
322 0.33
323 0.33
324 0.31
325 0.29
326 0.21
327 0.19
328 0.13
329 0.1
330 0.08
331 0.07
332 0.06
333 0.05
334 0.05
335 0.04
336 0.04
337 0.04
338 0.04
339 0.05
340 0.05
341 0.06
342 0.06
343 0.09
344 0.09
345 0.1
346 0.13
347 0.13
348 0.14
349 0.13
350 0.13
351 0.16
352 0.16
353 0.16
354 0.13
355 0.13
356 0.12
357 0.12
358 0.11
359 0.06
360 0.06
361 0.11
362 0.18
363 0.2
364 0.29
365 0.39
366 0.45
367 0.56
368 0.67
369 0.73
370 0.76
371 0.83
372 0.86
373 0.84
374 0.86
375 0.85
376 0.84
377 0.8
378 0.71
379 0.65
380 0.57
381 0.56
382 0.49
383 0.41
384 0.32
385 0.25
386 0.26
387 0.25
388 0.29
389 0.28