Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5Z9K8

Protein Details
Accession A0A2C5Z9K8    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
56-81VIEEHSPRRRSRRRSRSARPRSDYGPBasic
NLS Segment(s)
PositionSequence
62-76PRRRSRRRSRSARPR
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
Amino Acid Sequences MAHGLPQSYLRGLATVTARRRRRREETVEVREERFVVAPPVAVPPPAAVDDDEVVVIEEHSPRRRSRRRSRSARPRSDYGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.22
3 0.3
4 0.38
5 0.46
6 0.55
7 0.63
8 0.68
9 0.72
10 0.74
11 0.75
12 0.76
13 0.79
14 0.78
15 0.78
16 0.71
17 0.63
18 0.54
19 0.45
20 0.35
21 0.25
22 0.17
23 0.11
24 0.09
25 0.08
26 0.08
27 0.09
28 0.08
29 0.08
30 0.07
31 0.06
32 0.07
33 0.08
34 0.08
35 0.06
36 0.08
37 0.08
38 0.08
39 0.08
40 0.06
41 0.06
42 0.06
43 0.06
44 0.05
45 0.08
46 0.12
47 0.18
48 0.21
49 0.26
50 0.37
51 0.47
52 0.57
53 0.65
54 0.73
55 0.78
56 0.86
57 0.92
58 0.93
59 0.95
60 0.95
61 0.91