Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C6A7H5

Protein Details
Accession A0A2C6A7H5   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
34-63FFSDIRRLERHKKERRKRKEKPTGSFREDKBasic
NLS Segment(s)
PositionSequence
40-56RLERHKKERRKRKEKPT
Subcellular Location(s) cyto 12.5, cyto_nucl 11.5, nucl 9.5, mito 2
Family & Domain DBs
Amino Acid Sequences MDPDDFIFLTAGQIGEEGGPVKRFGEHVFFSTAFFSDIRRLERHKKERRKRKEKPTGSFREDKRTVDHLFIFPGRSQQLGLQRENLGYLALRPHAAFDTVSAAGWNGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.07
5 0.07
6 0.08
7 0.09
8 0.09
9 0.1
10 0.11
11 0.13
12 0.17
13 0.17
14 0.19
15 0.22
16 0.22
17 0.22
18 0.21
19 0.19
20 0.15
21 0.13
22 0.12
23 0.13
24 0.16
25 0.19
26 0.21
27 0.26
28 0.35
29 0.45
30 0.55
31 0.61
32 0.69
33 0.76
34 0.85
35 0.91
36 0.92
37 0.92
38 0.92
39 0.93
40 0.91
41 0.89
42 0.89
43 0.86
44 0.8
45 0.78
46 0.68
47 0.67
48 0.6
49 0.52
50 0.46
51 0.42
52 0.38
53 0.33
54 0.33
55 0.24
56 0.24
57 0.24
58 0.21
59 0.16
60 0.18
61 0.16
62 0.15
63 0.15
64 0.16
65 0.24
66 0.27
67 0.28
68 0.28
69 0.28
70 0.28
71 0.28
72 0.24
73 0.16
74 0.12
75 0.12
76 0.11
77 0.11
78 0.12
79 0.11
80 0.13
81 0.13
82 0.14
83 0.13
84 0.12
85 0.15
86 0.14
87 0.15
88 0.13