Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8LUS6

Protein Details
Accession B8LUS6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
115-140AQSFCGAKKKKEVKKARKYPTTPRQDHydrophilic
NLS Segment(s)
PositionSequence
122-132KKKKEVKKARK
Subcellular Location(s) mito 22, nucl 5
Family & Domain DBs
Amino Acid Sequences MDCIQTVFIRGCLQSRIHRTCIVYSALLNARRTPVKMHAASQLMGWIREYLGPKRHIFSSRLPTVPYPPPEWLLAQRALTEELPTPPDPLHKRNINNIKGSACTQINFTDTLAGAQSFCGAKKKKEVKKARKYPTTPRQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.38
3 0.42
4 0.43
5 0.47
6 0.47
7 0.45
8 0.44
9 0.39
10 0.3
11 0.24
12 0.26
13 0.28
14 0.3
15 0.29
16 0.27
17 0.28
18 0.29
19 0.3
20 0.28
21 0.29
22 0.33
23 0.34
24 0.34
25 0.36
26 0.36
27 0.35
28 0.31
29 0.28
30 0.21
31 0.19
32 0.17
33 0.12
34 0.1
35 0.13
36 0.16
37 0.16
38 0.22
39 0.26
40 0.27
41 0.29
42 0.32
43 0.32
44 0.32
45 0.35
46 0.37
47 0.37
48 0.37
49 0.36
50 0.33
51 0.34
52 0.36
53 0.32
54 0.26
55 0.22
56 0.23
57 0.23
58 0.23
59 0.2
60 0.18
61 0.17
62 0.15
63 0.15
64 0.14
65 0.15
66 0.14
67 0.13
68 0.11
69 0.1
70 0.13
71 0.13
72 0.13
73 0.12
74 0.19
75 0.22
76 0.25
77 0.31
78 0.35
79 0.37
80 0.46
81 0.56
82 0.54
83 0.53
84 0.53
85 0.47
86 0.42
87 0.41
88 0.36
89 0.27
90 0.22
91 0.2
92 0.19
93 0.19
94 0.18
95 0.16
96 0.13
97 0.12
98 0.12
99 0.11
100 0.1
101 0.08
102 0.08
103 0.1
104 0.09
105 0.1
106 0.18
107 0.21
108 0.24
109 0.35
110 0.46
111 0.52
112 0.62
113 0.73
114 0.75
115 0.83
116 0.9
117 0.9
118 0.91
119 0.89
120 0.9