Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C6AH94

Protein Details
Accession A0A2C6AH94   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
183-205RQVGRWARPTPRKTKEEKMHDAAHydrophilic
NLS Segment(s)
PositionSequence
55-56RR
189-195ARPTPRK
Subcellular Location(s) cyto 12, mito 10, nucl 2, plas 2
Family & Domain DBs
Amino Acid Sequences MRTRAGVVESSFVTPAASDFASGEWGRAVDGEPPPRFLGWAIGRLWRENLPRPARRRGERDAAGSSRDRSVRCGGDTSREVPSGRMALCVPSVRSEPTTSQLGPAVPPANLLVASFQPALTVPFLAGSSGRDALALPTPAVSRRRACRCLPAPPRSVVMLAGGPGWPLAGGARVRGASERLARQVGRWARPTPRKTKEEKMHDAAARWRYM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.11
4 0.09
5 0.08
6 0.08
7 0.09
8 0.14
9 0.13
10 0.13
11 0.11
12 0.11
13 0.11
14 0.11
15 0.11
16 0.12
17 0.17
18 0.25
19 0.25
20 0.28
21 0.3
22 0.29
23 0.29
24 0.24
25 0.27
26 0.21
27 0.25
28 0.23
29 0.28
30 0.29
31 0.3
32 0.32
33 0.28
34 0.31
35 0.34
36 0.42
37 0.46
38 0.53
39 0.57
40 0.65
41 0.69
42 0.71
43 0.7
44 0.67
45 0.68
46 0.63
47 0.62
48 0.57
49 0.5
50 0.46
51 0.41
52 0.36
53 0.3
54 0.3
55 0.26
56 0.24
57 0.28
58 0.27
59 0.26
60 0.28
61 0.25
62 0.28
63 0.29
64 0.28
65 0.25
66 0.25
67 0.24
68 0.2
69 0.21
70 0.18
71 0.16
72 0.15
73 0.12
74 0.11
75 0.13
76 0.13
77 0.12
78 0.11
79 0.12
80 0.12
81 0.13
82 0.14
83 0.14
84 0.16
85 0.18
86 0.16
87 0.16
88 0.16
89 0.14
90 0.13
91 0.13
92 0.11
93 0.08
94 0.09
95 0.08
96 0.07
97 0.07
98 0.07
99 0.06
100 0.05
101 0.07
102 0.07
103 0.06
104 0.06
105 0.06
106 0.07
107 0.07
108 0.07
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.07
116 0.07
117 0.07
118 0.07
119 0.07
120 0.08
121 0.1
122 0.1
123 0.08
124 0.09
125 0.09
126 0.13
127 0.16
128 0.19
129 0.22
130 0.3
131 0.38
132 0.43
133 0.44
134 0.51
135 0.53
136 0.59
137 0.63
138 0.62
139 0.58
140 0.55
141 0.55
142 0.46
143 0.42
144 0.31
145 0.24
146 0.17
147 0.13
148 0.11
149 0.09
150 0.08
151 0.07
152 0.07
153 0.05
154 0.04
155 0.04
156 0.08
157 0.08
158 0.09
159 0.11
160 0.11
161 0.12
162 0.14
163 0.15
164 0.16
165 0.22
166 0.25
167 0.26
168 0.3
169 0.3
170 0.3
171 0.38
172 0.4
173 0.41
174 0.43
175 0.44
176 0.51
177 0.6
178 0.67
179 0.69
180 0.71
181 0.72
182 0.75
183 0.8
184 0.81
185 0.81
186 0.82
187 0.78
188 0.76
189 0.71
190 0.68
191 0.65