Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5ZQ21

Protein Details
Accession A0A2C5ZQ21   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-72MSDQRKTKESKGQGQPKKESKEFKKGPRKEPIKEHKKESKNEPKKEPTKEHKKESKKEPKESSKKEPAKRKTBasic
NLS Segment(s)
PositionSequence
6-71KTKESKGQGQPKKESKEFKKGPRKEPIKEHKKESKNEPKKEPTKEHKKESKKEPKESSKKEPAKRK
136-152RPGGGKPGSGAKPGPRA
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSDQRKTKESKGQGQPKKESKEFKKGPRKEPIKEHKKESKNEPKKEPTKEHKKESKKEPKESSKKEPAKRKTLSLLDGAALFLAGDLSPEQDRAWTAALRKKYTPAWEYPFYEMMGKKARERYEARMAAEGIYRVRPGGGKPGSGAKPGPRASEPGSGANPAPRASGSGSSGGTSAGASGGKASSSGSLRPEDSASQVAARGSRRSHHTSSSSRRSGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.84
3 0.83
4 0.83
5 0.8
6 0.79
7 0.77
8 0.8
9 0.79
10 0.8
11 0.82
12 0.82
13 0.84
14 0.85
15 0.85
16 0.81
17 0.83
18 0.84
19 0.84
20 0.81
21 0.81
22 0.8
23 0.8
24 0.8
25 0.8
26 0.8
27 0.79
28 0.82
29 0.82
30 0.82
31 0.82
32 0.84
33 0.83
34 0.83
35 0.84
36 0.83
37 0.84
38 0.84
39 0.86
40 0.86
41 0.87
42 0.87
43 0.85
44 0.86
45 0.86
46 0.87
47 0.88
48 0.86
49 0.85
50 0.84
51 0.84
52 0.83
53 0.83
54 0.8
55 0.79
56 0.74
57 0.69
58 0.66
59 0.61
60 0.55
61 0.46
62 0.39
63 0.29
64 0.26
65 0.22
66 0.14
67 0.09
68 0.06
69 0.04
70 0.03
71 0.02
72 0.03
73 0.03
74 0.05
75 0.05
76 0.06
77 0.06
78 0.06
79 0.06
80 0.07
81 0.09
82 0.09
83 0.12
84 0.16
85 0.21
86 0.23
87 0.23
88 0.25
89 0.26
90 0.3
91 0.3
92 0.3
93 0.32
94 0.33
95 0.35
96 0.34
97 0.32
98 0.27
99 0.27
100 0.22
101 0.19
102 0.22
103 0.21
104 0.22
105 0.27
106 0.28
107 0.31
108 0.35
109 0.38
110 0.41
111 0.43
112 0.41
113 0.37
114 0.36
115 0.31
116 0.28
117 0.22
118 0.14
119 0.11
120 0.1
121 0.08
122 0.09
123 0.09
124 0.09
125 0.17
126 0.17
127 0.17
128 0.18
129 0.25
130 0.26
131 0.27
132 0.28
133 0.22
134 0.29
135 0.3
136 0.32
137 0.26
138 0.29
139 0.31
140 0.35
141 0.34
142 0.29
143 0.29
144 0.27
145 0.27
146 0.26
147 0.24
148 0.18
149 0.16
150 0.13
151 0.14
152 0.14
153 0.16
154 0.15
155 0.16
156 0.16
157 0.16
158 0.16
159 0.14
160 0.12
161 0.09
162 0.07
163 0.06
164 0.06
165 0.05
166 0.06
167 0.06
168 0.06
169 0.06
170 0.06
171 0.09
172 0.11
173 0.14
174 0.16
175 0.18
176 0.19
177 0.21
178 0.23
179 0.2
180 0.22
181 0.21
182 0.19
183 0.17
184 0.18
185 0.18
186 0.19
187 0.21
188 0.23
189 0.23
190 0.28
191 0.35
192 0.41
193 0.44
194 0.48
195 0.53
196 0.58
197 0.66
198 0.7