Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8MJ15

Protein Details
Accession B8MJ15    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
51-79ATPKVDKQEKPKQPKGRARKRLVYTRRFVHydrophilic
NLS Segment(s)
PositionSequence
46-71GKVKAATPKVDKQEKPKQPKGRARKR
Subcellular Location(s) nucl 13, mito 11, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MKQEFPNDCSRTTPGEKSWSILLYDRYPTTSTPLITSFAGSLARAGKVKAATPKVDKQEKPKQPKGRARKRLVYTRRFVNVTLTGGKRKMNPNPGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.4
4 0.39
5 0.38
6 0.33
7 0.29
8 0.27
9 0.27
10 0.22
11 0.24
12 0.23
13 0.22
14 0.22
15 0.21
16 0.22
17 0.21
18 0.19
19 0.18
20 0.18
21 0.18
22 0.17
23 0.17
24 0.12
25 0.11
26 0.1
27 0.08
28 0.08
29 0.07
30 0.08
31 0.08
32 0.08
33 0.09
34 0.1
35 0.12
36 0.17
37 0.18
38 0.21
39 0.25
40 0.31
41 0.36
42 0.43
43 0.44
44 0.47
45 0.55
46 0.61
47 0.66
48 0.7
49 0.73
50 0.75
51 0.83
52 0.85
53 0.86
54 0.87
55 0.86
56 0.86
57 0.84
58 0.84
59 0.84
60 0.82
61 0.76
62 0.73
63 0.71
64 0.63
65 0.55
66 0.51
67 0.44
68 0.39
69 0.4
70 0.36
71 0.35
72 0.36
73 0.39
74 0.39
75 0.44
76 0.49