Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5XGP3

Protein Details
Accession A0A2C5XGP3    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
22-43GQTSWHRKRRPFLRRMYFRSGAHydrophilic
NLS Segment(s)
PositionSequence
29-32KRRP
Subcellular Location(s) nucl 23, mito 2
Family & Domain DBs
Amino Acid Sequences MGLGGGGGGGDGGGGGGGQSDGQTSWHRKRRPFLRRMYFRSGARARPVCRSAGRRARLDRYDYLLAPRMTTQSPTRSEQTSERDLRHPGVGPRASGAPWQDRLPACTMM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.02
5 0.03
6 0.03
7 0.04
8 0.04
9 0.07
10 0.12
11 0.19
12 0.29
13 0.38
14 0.44
15 0.49
16 0.58
17 0.67
18 0.72
19 0.74
20 0.75
21 0.77
22 0.81
23 0.83
24 0.82
25 0.77
26 0.68
27 0.68
28 0.61
29 0.54
30 0.52
31 0.5
32 0.43
33 0.43
34 0.44
35 0.38
36 0.39
37 0.4
38 0.41
39 0.45
40 0.47
41 0.46
42 0.49
43 0.52
44 0.5
45 0.5
46 0.42
47 0.39
48 0.37
49 0.32
50 0.3
51 0.3
52 0.26
53 0.23
54 0.21
55 0.18
56 0.17
57 0.19
58 0.2
59 0.21
60 0.24
61 0.28
62 0.3
63 0.29
64 0.32
65 0.35
66 0.37
67 0.4
68 0.4
69 0.4
70 0.41
71 0.42
72 0.41
73 0.38
74 0.36
75 0.31
76 0.35
77 0.34
78 0.31
79 0.3
80 0.29
81 0.27
82 0.26
83 0.28
84 0.25
85 0.26
86 0.27
87 0.32
88 0.32
89 0.34