Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C6A0E3

Protein Details
Accession A0A2C6A0E3    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
53-78SLSARPPSERRRRTVRRAATRTRGASHydrophilic
NLS Segment(s)
PositionSequence
59-72PSERRRRTVRRAAT
Subcellular Location(s) extr 10, mito 6, nucl 5, cyto_mito 5
Family & Domain DBs
Amino Acid Sequences MDRTDMHTYIQTCHAVSRLAPGIQAGSLLVRSLGLDVVGDQAVAFHHPHTRMSLSARPPSERRRRTVRRAATRTRGASPATGPSFHSRPTAHTFAPCVASPSFLRGSAIAFFFLRGSGTAGSRGLFLLMMDVGRSGPLPLSLTATEPEEEAGFFSDRALCDGWVAARLFRAPPPGIQDKLSYGRYGRDTAARPALGTSPLPARPSVPSTPTAAAGTAAPAPGSRGTWTGHGWPPPVTESGRPVAGAGAASPFLPLVHSSSHPGNFSSPLLSRSPASPPPVSRQPRSRLGPSFLSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.21
3 0.2
4 0.23
5 0.23
6 0.21
7 0.21
8 0.2
9 0.19
10 0.18
11 0.18
12 0.11
13 0.08
14 0.08
15 0.08
16 0.07
17 0.06
18 0.06
19 0.07
20 0.06
21 0.05
22 0.05
23 0.05
24 0.07
25 0.07
26 0.07
27 0.06
28 0.06
29 0.06
30 0.08
31 0.09
32 0.08
33 0.13
34 0.15
35 0.16
36 0.19
37 0.21
38 0.22
39 0.27
40 0.33
41 0.33
42 0.39
43 0.41
44 0.43
45 0.48
46 0.55
47 0.61
48 0.61
49 0.61
50 0.65
51 0.72
52 0.77
53 0.82
54 0.82
55 0.82
56 0.84
57 0.86
58 0.84
59 0.82
60 0.75
61 0.68
62 0.6
63 0.5
64 0.43
65 0.36
66 0.34
67 0.28
68 0.25
69 0.24
70 0.26
71 0.27
72 0.26
73 0.29
74 0.22
75 0.25
76 0.31
77 0.33
78 0.29
79 0.29
80 0.29
81 0.27
82 0.29
83 0.24
84 0.2
85 0.16
86 0.17
87 0.16
88 0.18
89 0.17
90 0.15
91 0.15
92 0.12
93 0.13
94 0.13
95 0.13
96 0.1
97 0.09
98 0.09
99 0.09
100 0.08
101 0.07
102 0.06
103 0.07
104 0.07
105 0.07
106 0.08
107 0.09
108 0.09
109 0.09
110 0.08
111 0.07
112 0.06
113 0.05
114 0.05
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.03
123 0.03
124 0.04
125 0.05
126 0.05
127 0.08
128 0.08
129 0.09
130 0.09
131 0.1
132 0.1
133 0.08
134 0.08
135 0.06
136 0.06
137 0.05
138 0.06
139 0.06
140 0.05
141 0.06
142 0.07
143 0.07
144 0.08
145 0.09
146 0.07
147 0.07
148 0.07
149 0.07
150 0.09
151 0.09
152 0.08
153 0.08
154 0.09
155 0.09
156 0.1
157 0.14
158 0.12
159 0.13
160 0.19
161 0.23
162 0.23
163 0.24
164 0.23
165 0.23
166 0.27
167 0.27
168 0.22
169 0.18
170 0.2
171 0.21
172 0.22
173 0.2
174 0.21
175 0.23
176 0.25
177 0.29
178 0.26
179 0.23
180 0.23
181 0.22
182 0.19
183 0.16
184 0.14
185 0.14
186 0.16
187 0.17
188 0.16
189 0.16
190 0.17
191 0.22
192 0.23
193 0.22
194 0.22
195 0.24
196 0.25
197 0.25
198 0.22
199 0.18
200 0.15
201 0.13
202 0.12
203 0.09
204 0.08
205 0.07
206 0.06
207 0.08
208 0.08
209 0.09
210 0.09
211 0.1
212 0.12
213 0.14
214 0.17
215 0.2
216 0.24
217 0.26
218 0.26
219 0.25
220 0.26
221 0.25
222 0.26
223 0.23
224 0.21
225 0.22
226 0.23
227 0.23
228 0.21
229 0.19
230 0.17
231 0.15
232 0.13
233 0.09
234 0.07
235 0.07
236 0.07
237 0.07
238 0.06
239 0.06
240 0.07
241 0.07
242 0.08
243 0.11
244 0.13
245 0.17
246 0.22
247 0.24
248 0.25
249 0.25
250 0.25
251 0.25
252 0.24
253 0.24
254 0.21
255 0.22
256 0.23
257 0.23
258 0.22
259 0.22
260 0.28
261 0.29
262 0.33
263 0.36
264 0.37
265 0.44
266 0.53
267 0.58
268 0.6
269 0.64
270 0.66
271 0.7
272 0.73
273 0.73
274 0.7
275 0.68