Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C6AF48

Protein Details
Accession A0A2C6AF48    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
26-50DDRQGREPRSPSRRRPRPVSGARDEBasic
NLS Segment(s)
PositionSequence
31-43REPRSPSRRRPRP
62-119KGSRMPRLPRHRASRSHLLSRRPAARDTRRQPYLPRASSAPRRSALPWKRQRGSREKK
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MSDRCVHARHDAAAARQEAVQKAAADDRQGREPRSPSRRRPRPVSGARDEMAGQGSQPCAPKGSRMPRLPRHRASRSHLLSRRPAARDTRRQPYLPRASSAPRRSALPWKRQRGSREKKSYEEAGSLASCITSSRRTGHNFLAEKENPHTSRAKTILHSVSEDREETSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.3
3 0.29
4 0.31
5 0.26
6 0.24
7 0.24
8 0.18
9 0.19
10 0.22
11 0.21
12 0.22
13 0.26
14 0.27
15 0.33
16 0.37
17 0.37
18 0.39
19 0.44
20 0.5
21 0.55
22 0.62
23 0.63
24 0.71
25 0.79
26 0.81
27 0.84
28 0.83
29 0.83
30 0.83
31 0.81
32 0.76
33 0.71
34 0.63
35 0.56
36 0.47
37 0.37
38 0.29
39 0.2
40 0.13
41 0.09
42 0.1
43 0.11
44 0.11
45 0.11
46 0.12
47 0.12
48 0.16
49 0.23
50 0.31
51 0.38
52 0.43
53 0.52
54 0.59
55 0.69
56 0.74
57 0.73
58 0.73
59 0.71
60 0.71
61 0.69
62 0.69
63 0.64
64 0.65
65 0.62
66 0.57
67 0.55
68 0.54
69 0.53
70 0.44
71 0.43
72 0.42
73 0.45
74 0.51
75 0.52
76 0.55
77 0.54
78 0.53
79 0.53
80 0.55
81 0.56
82 0.47
83 0.43
84 0.38
85 0.4
86 0.47
87 0.48
88 0.43
89 0.34
90 0.35
91 0.36
92 0.44
93 0.46
94 0.48
95 0.54
96 0.58
97 0.62
98 0.66
99 0.72
100 0.72
101 0.75
102 0.75
103 0.77
104 0.72
105 0.71
106 0.7
107 0.67
108 0.58
109 0.49
110 0.38
111 0.3
112 0.25
113 0.21
114 0.16
115 0.11
116 0.09
117 0.08
118 0.1
119 0.1
120 0.12
121 0.16
122 0.22
123 0.27
124 0.31
125 0.37
126 0.43
127 0.43
128 0.43
129 0.49
130 0.45
131 0.43
132 0.43
133 0.46
134 0.38
135 0.39
136 0.41
137 0.35
138 0.41
139 0.42
140 0.42
141 0.36
142 0.43
143 0.45
144 0.43
145 0.44
146 0.39
147 0.39
148 0.38
149 0.36