Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C6A5J1

Protein Details
Accession A0A2C6A5J1    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
19-52IATRRRPASPASPRRRRRRHRHPTTRHSLRQRHPBasic
NLS Segment(s)
PositionSequence
22-50RRRPASPASPRRRRRRHRHPTTRHSLRQR
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MPALCVDDSSAAAGDATSIATRRRPASPASPRRRRRRHRHPTTRHSLRQRHPPPASDPPLSSPLLFSPSDDGDDDDDGCSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.06
4 0.05
5 0.06
6 0.08
7 0.11
8 0.14
9 0.17
10 0.19
11 0.21
12 0.25
13 0.34
14 0.43
15 0.51
16 0.59
17 0.67
18 0.74
19 0.83
20 0.89
21 0.9
22 0.9
23 0.91
24 0.91
25 0.92
26 0.94
27 0.93
28 0.92
29 0.92
30 0.9
31 0.87
32 0.85
33 0.82
34 0.76
35 0.77
36 0.73
37 0.73
38 0.66
39 0.61
40 0.59
41 0.59
42 0.59
43 0.5
44 0.46
45 0.4
46 0.41
47 0.39
48 0.32
49 0.23
50 0.19
51 0.2
52 0.19
53 0.16
54 0.16
55 0.16
56 0.18
57 0.17
58 0.18
59 0.16
60 0.17
61 0.17