Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5ZZ57

Protein Details
Accession A0A2C5ZZ57   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
12-45AGPQRAPKLSHKKSRYGCQRCRQRRVKVSQDTGEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005481  BC-like_N  
IPR011764  Biotin_carboxylation_dom  
IPR016185  PreATP-grasp_dom_sf  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016874  F:ligase activity  
Pfam View protein in Pfam  
PF00289  Biotin_carb_N  
PROSITE View protein in PROSITE  
PS50979  BC  
Amino Acid Sequences MFGQYYIGVASAGPQRAPKLSHKKSRYGCQRCRQRRVKVSQDTGEIAVRILQAARELPEPVETFALYTADDDAHCRLGRPKHAIRLPSPAAYLDVAGLVGLAREHAIDAVHPGYGFLSESAELARRMWAEAGARRPMSAALEGFHYARCLVEQEGRNMLAGRRPDPKRQSALPPPHHLPGVIDEEPCIIGRDSCDWTAMQAFLDGRTADFDGDDILPAWEQYADLGGLTEIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.23
4 0.28
5 0.34
6 0.4
7 0.49
8 0.58
9 0.62
10 0.7
11 0.74
12 0.81
13 0.82
14 0.82
15 0.82
16 0.82
17 0.88
18 0.88
19 0.92
20 0.91
21 0.9
22 0.89
23 0.89
24 0.89
25 0.88
26 0.85
27 0.78
28 0.72
29 0.64
30 0.55
31 0.46
32 0.36
33 0.26
34 0.19
35 0.15
36 0.11
37 0.09
38 0.08
39 0.08
40 0.09
41 0.11
42 0.1
43 0.11
44 0.11
45 0.14
46 0.15
47 0.15
48 0.15
49 0.13
50 0.12
51 0.11
52 0.11
53 0.08
54 0.07
55 0.07
56 0.07
57 0.07
58 0.08
59 0.09
60 0.11
61 0.11
62 0.12
63 0.17
64 0.21
65 0.28
66 0.34
67 0.37
68 0.43
69 0.47
70 0.5
71 0.46
72 0.49
73 0.46
74 0.39
75 0.35
76 0.26
77 0.24
78 0.2
79 0.18
80 0.09
81 0.07
82 0.05
83 0.05
84 0.04
85 0.03
86 0.03
87 0.02
88 0.02
89 0.02
90 0.02
91 0.03
92 0.03
93 0.03
94 0.03
95 0.05
96 0.05
97 0.05
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.04
104 0.04
105 0.04
106 0.04
107 0.05
108 0.06
109 0.06
110 0.06
111 0.08
112 0.07
113 0.07
114 0.08
115 0.08
116 0.1
117 0.13
118 0.17
119 0.19
120 0.19
121 0.19
122 0.19
123 0.18
124 0.17
125 0.15
126 0.11
127 0.08
128 0.09
129 0.1
130 0.11
131 0.1
132 0.09
133 0.08
134 0.08
135 0.07
136 0.07
137 0.08
138 0.14
139 0.16
140 0.18
141 0.21
142 0.21
143 0.21
144 0.21
145 0.2
146 0.17
147 0.18
148 0.19
149 0.25
150 0.29
151 0.38
152 0.43
153 0.49
154 0.51
155 0.53
156 0.58
157 0.59
158 0.66
159 0.64
160 0.64
161 0.61
162 0.58
163 0.54
164 0.45
165 0.37
166 0.3
167 0.31
168 0.25
169 0.21
170 0.19
171 0.19
172 0.2
173 0.19
174 0.16
175 0.1
176 0.09
177 0.1
178 0.14
179 0.17
180 0.17
181 0.18
182 0.16
183 0.17
184 0.19
185 0.17
186 0.14
187 0.13
188 0.13
189 0.12
190 0.14
191 0.13
192 0.11
193 0.13
194 0.14
195 0.11
196 0.11
197 0.1
198 0.1
199 0.1
200 0.11
201 0.09
202 0.09
203 0.09
204 0.09
205 0.09
206 0.07
207 0.07
208 0.07
209 0.08
210 0.07
211 0.07
212 0.07