Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5Z956

Protein Details
Accession A0A2C5Z956    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
44-69RSATRWKTPLERRRSRRPDELLRYEWHydrophilic
NLS Segment(s)
PositionSequence
55-58RRRS
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MRSRRDDDADDAEWCRLCECCGRRWGWYCWCDWWYWWPRSGPARSATRWKTPLERRRSRRPDELLRYEWSVSSPER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.2
3 0.14
4 0.13
5 0.19
6 0.2
7 0.24
8 0.3
9 0.32
10 0.37
11 0.41
12 0.46
13 0.46
14 0.45
15 0.41
16 0.39
17 0.39
18 0.33
19 0.29
20 0.31
21 0.3
22 0.3
23 0.31
24 0.28
25 0.31
26 0.37
27 0.38
28 0.32
29 0.31
30 0.34
31 0.33
32 0.41
33 0.41
34 0.42
35 0.44
36 0.43
37 0.47
38 0.52
39 0.6
40 0.61
41 0.68
42 0.68
43 0.77
44 0.84
45 0.81
46 0.81
47 0.8
48 0.81
49 0.8
50 0.8
51 0.73
52 0.68
53 0.63
54 0.55
55 0.46
56 0.37