Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5YSN1

Protein Details
Accession A0A2C5YSN1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGKRKSSRKPMGPKKVDPLPBasic
NLS Segment(s)
PositionSequence
3-14KRKSSRKPMGPK
Subcellular Location(s) cyto 22, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKSSRKPMGPKKVDPLPTTFTCLFCNHEKSVTVKLDRKAGIGQLDCRVCGQTFQCAVNYLSAAVDVYGEWVDAADAVAKEDTVVGAFGSSSNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.76
4 0.66
5 0.6
6 0.56
7 0.48
8 0.49
9 0.43
10 0.36
11 0.31
12 0.31
13 0.3
14 0.28
15 0.31
16 0.26
17 0.26
18 0.26
19 0.27
20 0.32
21 0.32
22 0.33
23 0.33
24 0.34
25 0.38
26 0.37
27 0.35
28 0.29
29 0.27
30 0.25
31 0.21
32 0.21
33 0.2
34 0.19
35 0.18
36 0.18
37 0.16
38 0.13
39 0.14
40 0.13
41 0.13
42 0.15
43 0.15
44 0.15
45 0.17
46 0.17
47 0.16
48 0.15
49 0.11
50 0.08
51 0.08
52 0.07
53 0.05
54 0.05
55 0.04
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.06
65 0.06
66 0.07
67 0.07
68 0.07
69 0.07
70 0.07
71 0.08
72 0.06
73 0.06
74 0.05
75 0.05
76 0.05