Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5ZVD7

Protein Details
Accession A0A2C5ZVD7    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
5-31GLAPRLKDPRRRAPTNRLRDRRRLFAFHydrophilic
NLS Segment(s)
PositionSequence
9-27RLKDPRRRAPTNRLRDRRR
Subcellular Location(s) nucl 16, cyto_nucl 12.5, cyto 7, mito 4
Family & Domain DBs
Amino Acid Sequences MRAAGLAPRLKDPRRRAPTNRLRDRRRLFAFRRCAFHSPRAAVGQRPCPLDAADADADTCPPSPGPDPVPRPLFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.72
3 0.73
4 0.77
5 0.82
6 0.83
7 0.86
8 0.85
9 0.82
10 0.84
11 0.82
12 0.8
13 0.77
14 0.75
15 0.7
16 0.69
17 0.72
18 0.65
19 0.65
20 0.59
21 0.57
22 0.51
23 0.51
24 0.46
25 0.37
26 0.36
27 0.35
28 0.32
29 0.31
30 0.31
31 0.32
32 0.31
33 0.31
34 0.29
35 0.26
36 0.26
37 0.23
38 0.19
39 0.17
40 0.14
41 0.13
42 0.13
43 0.12
44 0.12
45 0.11
46 0.11
47 0.08
48 0.07
49 0.1
50 0.12
51 0.16
52 0.22
53 0.3
54 0.35
55 0.42