Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C6A5D4

Protein Details
Accession A0A2C6A5D4    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
192-222AHVPRRRRRASEPIQPPRRRARRPSWMPGLPBasic
NLS Segment(s)
PositionSequence
191-215SAHVPRRRRRASEPIQPPRRRARRP
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
Amino Acid Sequences MNYTEDEDCGRIDWSSSSIQPTSQPASQPPLPLSLSLSIIIPSLPPLLGRGSRRGRLVAAVVGPRLPLTGPAYRPLSLHRRPRPRWTLAVPYHLSFYLAARTAPPADPRHGCWTAAYRGPSPHDPKAATNTASSERPSAPPGPSSGARPRDRRSSHTPRHTPPLEPWAPVRFAWRALTGPEPRLPPHHQPSAHVPRRRRRASEPIQPPRRRARRPSWMPGLPLSLPYATASPSSRLGPDGMPRLHIYGARS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.17
4 0.21
5 0.2
6 0.21
7 0.23
8 0.27
9 0.29
10 0.28
11 0.29
12 0.27
13 0.34
14 0.36
15 0.36
16 0.32
17 0.32
18 0.3
19 0.28
20 0.27
21 0.22
22 0.21
23 0.18
24 0.17
25 0.13
26 0.12
27 0.11
28 0.09
29 0.08
30 0.08
31 0.07
32 0.07
33 0.08
34 0.11
35 0.16
36 0.19
37 0.27
38 0.32
39 0.36
40 0.38
41 0.39
42 0.36
43 0.33
44 0.32
45 0.26
46 0.23
47 0.21
48 0.19
49 0.18
50 0.17
51 0.14
52 0.13
53 0.1
54 0.09
55 0.11
56 0.16
57 0.17
58 0.21
59 0.24
60 0.24
61 0.25
62 0.28
63 0.33
64 0.36
65 0.45
66 0.5
67 0.58
68 0.62
69 0.72
70 0.74
71 0.7
72 0.69
73 0.64
74 0.65
75 0.57
76 0.6
77 0.52
78 0.44
79 0.41
80 0.34
81 0.29
82 0.19
83 0.17
84 0.12
85 0.1
86 0.1
87 0.09
88 0.1
89 0.11
90 0.12
91 0.16
92 0.16
93 0.19
94 0.21
95 0.24
96 0.3
97 0.29
98 0.28
99 0.24
100 0.26
101 0.25
102 0.27
103 0.26
104 0.2
105 0.2
106 0.23
107 0.28
108 0.29
109 0.29
110 0.29
111 0.28
112 0.27
113 0.31
114 0.3
115 0.25
116 0.21
117 0.2
118 0.2
119 0.2
120 0.19
121 0.16
122 0.15
123 0.15
124 0.17
125 0.18
126 0.16
127 0.16
128 0.17
129 0.18
130 0.18
131 0.21
132 0.26
133 0.32
134 0.37
135 0.41
136 0.43
137 0.5
138 0.52
139 0.55
140 0.57
141 0.59
142 0.64
143 0.69
144 0.72
145 0.66
146 0.72
147 0.67
148 0.6
149 0.52
150 0.52
151 0.43
152 0.37
153 0.36
154 0.3
155 0.3
156 0.28
157 0.29
158 0.2
159 0.2
160 0.21
161 0.2
162 0.18
163 0.18
164 0.24
165 0.23
166 0.26
167 0.27
168 0.27
169 0.27
170 0.32
171 0.36
172 0.38
173 0.42
174 0.47
175 0.43
176 0.45
177 0.54
178 0.59
179 0.62
180 0.6
181 0.62
182 0.64
183 0.74
184 0.78
185 0.74
186 0.71
187 0.73
188 0.75
189 0.77
190 0.79
191 0.79
192 0.83
193 0.81
194 0.8
195 0.8
196 0.81
197 0.79
198 0.78
199 0.77
200 0.78
201 0.82
202 0.85
203 0.84
204 0.78
205 0.72
206 0.65
207 0.59
208 0.48
209 0.41
210 0.33
211 0.24
212 0.2
213 0.18
214 0.16
215 0.12
216 0.15
217 0.15
218 0.16
219 0.18
220 0.2
221 0.19
222 0.2
223 0.21
224 0.22
225 0.26
226 0.32
227 0.3
228 0.32
229 0.32
230 0.33
231 0.33