Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5ZK03

Protein Details
Accession A0A2C5ZK03    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
51-71RICAVGSVRRKPKSRKVWTGAHydrophilic
NLS Segment(s)
PositionSequence
60-65RKPKSR
Subcellular Location(s) mito 20.5, mito_nucl 13.833, nucl 6
Family & Domain DBs
Amino Acid Sequences MRSAASRSSPSAPSARPKAVPMRASQWRSSSSNVSRSAHDEILMSSAKPLRICAVGSVRRKPKSRKVWTGAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.41
3 0.38
4 0.41
5 0.45
6 0.47
7 0.46
8 0.41
9 0.42
10 0.46
11 0.49
12 0.47
13 0.42
14 0.39
15 0.39
16 0.39
17 0.38
18 0.33
19 0.36
20 0.37
21 0.36
22 0.32
23 0.33
24 0.34
25 0.27
26 0.24
27 0.18
28 0.14
29 0.15
30 0.14
31 0.11
32 0.09
33 0.11
34 0.12
35 0.12
36 0.13
37 0.12
38 0.13
39 0.14
40 0.17
41 0.23
42 0.3
43 0.36
44 0.45
45 0.51
46 0.58
47 0.65
48 0.7
49 0.72
50 0.76
51 0.8
52 0.82