Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8LUA9

Protein Details
Accession B8LUA9    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MLQQRAQRRRKAIPNEWKAALHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 12.5, mito 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR041188  HTH_ABP1_N  
IPR006600  HTH_CenpB_DNA-bd_dom  
Pfam View protein in Pfam  
PF18107  HTH_ABP1_N  
PF03221  HTH_Tnp_Tc5  
Amino Acid Sequences MLQQRAQRRRKAIPNEWKAALRAPHRINHHLTHQNLRKWFEDTYNQPIDRATVTRILSSKYAFIDELQEYQLKDKRHRVEQWPELEKAVMDWIRLAETEAPISQEAIRYKAQQYWDMPARVLIIQPKPPVPLFSSKACPTCLTDKILSRFPPFNMQTKKTVTIAYRRVSSIISYIIREHIKKMYGAIQYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.76
4 0.69
5 0.6
6 0.56
7 0.52
8 0.45
9 0.45
10 0.43
11 0.45
12 0.49
13 0.54
14 0.53
15 0.5
16 0.55
17 0.54
18 0.53
19 0.58
20 0.59
21 0.59
22 0.59
23 0.59
24 0.52
25 0.46
26 0.44
27 0.39
28 0.39
29 0.38
30 0.4
31 0.44
32 0.42
33 0.4
34 0.38
35 0.34
36 0.28
37 0.25
38 0.19
39 0.17
40 0.18
41 0.2
42 0.21
43 0.21
44 0.21
45 0.21
46 0.21
47 0.16
48 0.16
49 0.14
50 0.13
51 0.15
52 0.14
53 0.15
54 0.14
55 0.15
56 0.14
57 0.17
58 0.21
59 0.2
60 0.24
61 0.31
62 0.35
63 0.41
64 0.47
65 0.51
66 0.56
67 0.6
68 0.63
69 0.59
70 0.54
71 0.47
72 0.41
73 0.33
74 0.23
75 0.2
76 0.13
77 0.09
78 0.08
79 0.08
80 0.08
81 0.09
82 0.09
83 0.06
84 0.06
85 0.07
86 0.07
87 0.07
88 0.07
89 0.08
90 0.07
91 0.1
92 0.1
93 0.13
94 0.14
95 0.15
96 0.16
97 0.19
98 0.21
99 0.22
100 0.22
101 0.26
102 0.29
103 0.28
104 0.27
105 0.24
106 0.24
107 0.19
108 0.19
109 0.18
110 0.16
111 0.2
112 0.22
113 0.22
114 0.23
115 0.23
116 0.24
117 0.22
118 0.26
119 0.25
120 0.28
121 0.33
122 0.33
123 0.35
124 0.35
125 0.33
126 0.3
127 0.32
128 0.31
129 0.3
130 0.3
131 0.34
132 0.37
133 0.41
134 0.41
135 0.4
136 0.4
137 0.37
138 0.42
139 0.39
140 0.45
141 0.47
142 0.47
143 0.48
144 0.5
145 0.52
146 0.44
147 0.46
148 0.4
149 0.42
150 0.46
151 0.45
152 0.43
153 0.4
154 0.4
155 0.36
156 0.33
157 0.26
158 0.25
159 0.22
160 0.21
161 0.21
162 0.26
163 0.3
164 0.3
165 0.31
166 0.3
167 0.31
168 0.3
169 0.32
170 0.33