Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5ZZP2

Protein Details
Accession A0A2C5ZZP2    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
212-231DDERAEWERRRNEKQHGRAVBasic
NLS Segment(s)
PositionSequence
178-178K
Subcellular Location(s) cyto_nucl 13, nucl 12.5, cyto 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
Pfam View protein in Pfam  
PF12796  Ank_2  
PROSITE View protein in PROSITE  
PS50088  ANK_REPEAT  
Amino Acid Sequences MAGDEEHEGASVAEILIEACRRNNTELLTDTLAGRPDADVSALLNDTTTVMGNHLYHEAASRGNYEIIDLLLDQPDFECDPTNRSEGDTPLHSAIRWLNGEPPAQRPFGRALVDMMLEAGSSPRARNAAGLTPAQLVDPANPDLRLLIEQHLYASQNAGDFANVDDDDDDDRHKQKHKRRGAGEDDAAPAAAPAPAHDDDDDDDAEFSGSDDDERAEWERRRNEKQHGRAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.07
4 0.09
5 0.09
6 0.11
7 0.15
8 0.18
9 0.21
10 0.24
11 0.24
12 0.28
13 0.29
14 0.31
15 0.3
16 0.28
17 0.26
18 0.25
19 0.23
20 0.18
21 0.16
22 0.12
23 0.11
24 0.1
25 0.1
26 0.08
27 0.08
28 0.09
29 0.09
30 0.09
31 0.07
32 0.07
33 0.07
34 0.07
35 0.07
36 0.06
37 0.06
38 0.08
39 0.08
40 0.1
41 0.1
42 0.1
43 0.09
44 0.1
45 0.11
46 0.1
47 0.11
48 0.11
49 0.11
50 0.12
51 0.11
52 0.11
53 0.1
54 0.09
55 0.08
56 0.07
57 0.06
58 0.07
59 0.07
60 0.06
61 0.06
62 0.07
63 0.08
64 0.08
65 0.1
66 0.09
67 0.12
68 0.14
69 0.15
70 0.14
71 0.15
72 0.17
73 0.15
74 0.17
75 0.16
76 0.16
77 0.17
78 0.17
79 0.15
80 0.15
81 0.14
82 0.15
83 0.14
84 0.13
85 0.14
86 0.16
87 0.19
88 0.18
89 0.22
90 0.21
91 0.22
92 0.21
93 0.2
94 0.2
95 0.22
96 0.22
97 0.17
98 0.16
99 0.15
100 0.15
101 0.13
102 0.1
103 0.06
104 0.05
105 0.04
106 0.04
107 0.04
108 0.04
109 0.05
110 0.06
111 0.06
112 0.07
113 0.08
114 0.1
115 0.12
116 0.14
117 0.14
118 0.14
119 0.14
120 0.14
121 0.13
122 0.11
123 0.08
124 0.07
125 0.09
126 0.1
127 0.1
128 0.1
129 0.1
130 0.1
131 0.1
132 0.1
133 0.09
134 0.09
135 0.09
136 0.09
137 0.1
138 0.11
139 0.12
140 0.11
141 0.1
142 0.09
143 0.08
144 0.09
145 0.08
146 0.07
147 0.06
148 0.07
149 0.09
150 0.08
151 0.08
152 0.07
153 0.08
154 0.1
155 0.1
156 0.12
157 0.12
158 0.15
159 0.19
160 0.27
161 0.35
162 0.43
163 0.53
164 0.61
165 0.68
166 0.72
167 0.77
168 0.77
169 0.77
170 0.71
171 0.63
172 0.54
173 0.45
174 0.37
175 0.28
176 0.2
177 0.12
178 0.09
179 0.06
180 0.05
181 0.1
182 0.11
183 0.13
184 0.13
185 0.14
186 0.15
187 0.18
188 0.18
189 0.13
190 0.13
191 0.11
192 0.11
193 0.1
194 0.09
195 0.07
196 0.07
197 0.06
198 0.07
199 0.08
200 0.08
201 0.11
202 0.14
203 0.21
204 0.25
205 0.34
206 0.43
207 0.51
208 0.6
209 0.65
210 0.73
211 0.76