Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5YXV2

Protein Details
Accession A0A2C5YXV2   
Localization Confidence High
Confidence Score 22.5
NoLS Segment(s)
PositionSequenceProtein Nature
8-30PVPFSEPRKRGRPPKASKQFSDSHydrophilic
107-126EPASEPRKRGRPPKAANPLQHydrophilic
137-156GPKPSGVEKKRGRGRPRKTVBasic
NLS Segment(s)
PositionSequence
15-22RKRGRPPK
79-82RGRP
110-156SEPRKRGRPPKAANPLQAAEKKGPPSAGPKPSGVEKKRGRGRPRKTV
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MEQRPASPVPFSEPRKRGRPPKASKQFSDSVQSNVVQDDVMQADTIQSEVVQADAIQSDAVQSDVVQSDVVQSDIVRRRGRPPKASKQLSEAVSEAVQSPQAPKASEPASEPRKRGRPPKAANPLQAAEKKGPPSAGPKPSGVEKKRGRGRPRKTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.62
3 0.71
4 0.74
5 0.75
6 0.79
7 0.79
8 0.84
9 0.87
10 0.86
11 0.81
12 0.77
13 0.71
14 0.63
15 0.6
16 0.51
17 0.43
18 0.38
19 0.35
20 0.28
21 0.24
22 0.21
23 0.13
24 0.11
25 0.1
26 0.08
27 0.07
28 0.07
29 0.06
30 0.06
31 0.06
32 0.07
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.03
50 0.04
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.06
57 0.06
58 0.05
59 0.05
60 0.1
61 0.16
62 0.21
63 0.22
64 0.23
65 0.31
66 0.4
67 0.46
68 0.5
69 0.54
70 0.59
71 0.68
72 0.72
73 0.64
74 0.61
75 0.61
76 0.52
77 0.45
78 0.34
79 0.25
80 0.21
81 0.2
82 0.15
83 0.09
84 0.08
85 0.07
86 0.08
87 0.1
88 0.12
89 0.12
90 0.12
91 0.16
92 0.17
93 0.18
94 0.19
95 0.25
96 0.33
97 0.37
98 0.39
99 0.43
100 0.5
101 0.56
102 0.63
103 0.64
104 0.66
105 0.69
106 0.78
107 0.8
108 0.78
109 0.76
110 0.71
111 0.63
112 0.59
113 0.55
114 0.48
115 0.41
116 0.4
117 0.37
118 0.34
119 0.33
120 0.28
121 0.33
122 0.38
123 0.41
124 0.39
125 0.39
126 0.4
127 0.47
128 0.56
129 0.51
130 0.53
131 0.54
132 0.62
133 0.7
134 0.76
135 0.78
136 0.79