Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5YU82

Protein Details
Accession A0A2C5YU82   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
66-108EAPPAEKRIKRERRTSRSSPDAESGPKPRGGKKQRRGAHKFLTBasic
NLS Segment(s)
PositionSequence
67-121APPAEKRIKRERRTSRSSPDAESGPKPRGGKKQRRGAHKFLTGEDKAAAVRARKL
Subcellular Location(s) nucl 16, cyto 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011257  DNA_glycosylase  
IPR003265  HhH-GPD_domain  
IPR023170  HhH_base_excis_C  
Gene Ontology GO:0000702  F:oxidized base lesion DNA N-glycosylase activity  
GO:0006285  P:base-excision repair, AP site formation  
Pfam View protein in Pfam  
PF00730  HhH-GPD  
CDD cd00056  ENDO3c  
Amino Acid Sequences MASSPPPPAVERPLRRSARNLKLQADIRTDEALVKQEEEAASSARNLKRPADIKTDEEAPIKREDEAPPAEKRIKRERRTSRSSPDAESGPKPRGGKKQRRGAHKFLTGEDKAAAVRARKLKLFSALSKRSPFPDWGSPRPEECALAHEILARLEGEPKRAAQVVAPRTSAGCGSSPSVLDALVRTILSQNTSGKNSALAKRRMDEVYGGSDRWEAIVDGGQPKLEVAIRRGGLSVVKSNVILALLRDVRAAHGVYSLDHLFDADDETAMREMLSYRGVGPKTASCVLLFCLQRDSFAVDTHVYRLAGILGWRPPTATREETQAHLNLLVPPEEKYPLHVLMIRHGQNCDECRAGGKVRGKCELRNAFPIKPARATAVEDAKEQEGMKAVKKEEDQPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.65
3 0.71
4 0.72
5 0.72
6 0.73
7 0.72
8 0.66
9 0.68
10 0.71
11 0.67
12 0.62
13 0.54
14 0.46
15 0.41
16 0.38
17 0.31
18 0.27
19 0.26
20 0.21
21 0.2
22 0.18
23 0.2
24 0.19
25 0.19
26 0.18
27 0.15
28 0.14
29 0.16
30 0.23
31 0.24
32 0.29
33 0.3
34 0.32
35 0.39
36 0.43
37 0.46
38 0.48
39 0.47
40 0.47
41 0.48
42 0.49
43 0.43
44 0.43
45 0.39
46 0.33
47 0.34
48 0.3
49 0.28
50 0.28
51 0.27
52 0.29
53 0.33
54 0.35
55 0.34
56 0.39
57 0.46
58 0.45
59 0.5
60 0.54
61 0.59
62 0.63
63 0.7
64 0.75
65 0.77
66 0.83
67 0.85
68 0.82
69 0.81
70 0.77
71 0.7
72 0.62
73 0.56
74 0.51
75 0.48
76 0.43
77 0.37
78 0.38
79 0.37
80 0.4
81 0.47
82 0.54
83 0.6
84 0.65
85 0.71
86 0.74
87 0.82
88 0.83
89 0.81
90 0.78
91 0.75
92 0.67
93 0.6
94 0.61
95 0.51
96 0.44
97 0.36
98 0.27
99 0.2
100 0.2
101 0.2
102 0.13
103 0.19
104 0.24
105 0.27
106 0.29
107 0.31
108 0.31
109 0.36
110 0.38
111 0.39
112 0.43
113 0.46
114 0.49
115 0.5
116 0.49
117 0.45
118 0.43
119 0.39
120 0.35
121 0.38
122 0.4
123 0.42
124 0.46
125 0.44
126 0.43
127 0.43
128 0.38
129 0.3
130 0.24
131 0.21
132 0.18
133 0.17
134 0.16
135 0.14
136 0.14
137 0.12
138 0.12
139 0.09
140 0.07
141 0.13
142 0.13
143 0.14
144 0.15
145 0.15
146 0.17
147 0.17
148 0.17
149 0.13
150 0.21
151 0.23
152 0.25
153 0.25
154 0.23
155 0.23
156 0.23
157 0.21
158 0.14
159 0.09
160 0.08
161 0.09
162 0.09
163 0.09
164 0.09
165 0.09
166 0.08
167 0.07
168 0.06
169 0.06
170 0.06
171 0.05
172 0.05
173 0.06
174 0.07
175 0.08
176 0.09
177 0.12
178 0.13
179 0.15
180 0.15
181 0.14
182 0.17
183 0.19
184 0.24
185 0.29
186 0.31
187 0.31
188 0.31
189 0.35
190 0.32
191 0.29
192 0.24
193 0.18
194 0.19
195 0.19
196 0.17
197 0.14
198 0.14
199 0.13
200 0.12
201 0.11
202 0.05
203 0.05
204 0.06
205 0.07
206 0.08
207 0.09
208 0.08
209 0.08
210 0.08
211 0.08
212 0.09
213 0.09
214 0.09
215 0.14
216 0.15
217 0.15
218 0.16
219 0.15
220 0.15
221 0.15
222 0.16
223 0.12
224 0.12
225 0.12
226 0.11
227 0.11
228 0.1
229 0.09
230 0.06
231 0.09
232 0.09
233 0.1
234 0.1
235 0.1
236 0.1
237 0.12
238 0.12
239 0.08
240 0.09
241 0.09
242 0.09
243 0.12
244 0.11
245 0.1
246 0.09
247 0.09
248 0.07
249 0.07
250 0.09
251 0.06
252 0.06
253 0.06
254 0.07
255 0.07
256 0.07
257 0.07
258 0.05
259 0.06
260 0.07
261 0.08
262 0.07
263 0.08
264 0.14
265 0.14
266 0.15
267 0.16
268 0.16
269 0.2
270 0.22
271 0.21
272 0.16
273 0.16
274 0.17
275 0.22
276 0.21
277 0.17
278 0.21
279 0.2
280 0.21
281 0.21
282 0.23
283 0.17
284 0.18
285 0.19
286 0.15
287 0.16
288 0.17
289 0.18
290 0.14
291 0.13
292 0.13
293 0.11
294 0.11
295 0.11
296 0.13
297 0.13
298 0.16
299 0.16
300 0.16
301 0.17
302 0.19
303 0.24
304 0.25
305 0.23
306 0.27
307 0.29
308 0.3
309 0.33
310 0.32
311 0.27
312 0.24
313 0.24
314 0.19
315 0.19
316 0.19
317 0.16
318 0.16
319 0.17
320 0.2
321 0.18
322 0.2
323 0.23
324 0.22
325 0.24
326 0.26
327 0.25
328 0.28
329 0.37
330 0.38
331 0.35
332 0.34
333 0.35
334 0.37
335 0.39
336 0.37
337 0.29
338 0.25
339 0.26
340 0.29
341 0.3
342 0.31
343 0.37
344 0.38
345 0.41
346 0.5
347 0.5
348 0.5
349 0.58
350 0.59
351 0.56
352 0.61
353 0.61
354 0.55
355 0.59
356 0.63
357 0.57
358 0.51
359 0.48
360 0.42
361 0.4
362 0.41
363 0.41
364 0.42
365 0.4
366 0.37
367 0.39
368 0.35
369 0.35
370 0.3
371 0.25
372 0.22
373 0.24
374 0.28
375 0.32
376 0.32
377 0.36
378 0.39