Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2C5YAZ8

Protein Details
Accession A0A2C5YAZ8    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
590-616AILQSTGERNPKRRREKGDEASPRSLPHydrophilic
NLS Segment(s)
PositionSequence
600-608PKRRREKGD
Subcellular Location(s) cyto_nucl 10.333, cyto 10, nucl 9.5, cyto_mito 7.833, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037518  MPN  
IPR016563  Npl4  
IPR007717  NPL4_C  
IPR007716  NPL4_Zn-bd_put  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0031965  C:nuclear membrane  
GO:0048471  C:perinuclear region of cytoplasm  
GO:0051028  P:mRNA transport  
GO:0015031  P:protein transport  
GO:0006511  P:ubiquitin-dependent protein catabolic process  
Pfam View protein in Pfam  
PF05021  NPL4  
PF05020  zf-NPL4  
PROSITE View protein in PROSITE  
PS50249  MPN  
CDD cd08061  MPN_NPL4  
cd17055  Ubl_AtNPL4_like  
Amino Acid Sequences MLLRLRGPDGMVRLTVETSTTFGELGQKLVPQLPSTVDPRSLTMSNAPTGGDAKKLMDIANFKVAQIGLKHGDLIFINYAHRASDTNGEANGTAPAAGVSSARLNGKPVLPNEDVPVNPRPERIARPWEVVQQSALDDRLDKLDGKIPRGRDRMCRHGPKGMCDYCQPLDPFDPAYLADKSIKYTSFHSHLRKVNASTNKPELGSSYIPPLVEPFFRVRADCPTGHPPWPGGVCSKCQPSAITLNPQSFRMVDHVEFASPSIVDAFIDAWRRSGSQRIGFLYGRYAEYAEVPLGVKAVVEAIYEPPQLDESDGITMNAWENRAEVDEVAKLCALEPVGVIWTDLLDAGQGDGSVVCKRHADAYFLSSLEICFSARLQAQHPRASKWSDTGRFGSSFVTCLVSGNESGEIAISSYQMSNDAVEMVRADIVEPSADPNVMLVRDEEEDDGSVSRTRYIPEVFYRKVNEYGANVQENAKPSFPVEYLFVTLTHGFPASPRPVFTQTGFPIENRAHVGEGQEHSDLSKALGAGPNAKPSDGLQEVSNFHLLCFLYRMGVLSRDEFALLCRVASQHDLADSFQLRSTEGWQTLQAILQSTGERNPKRRREKGDEASPRSLPVREPDEPLAKRFAAFRLNQRRPSGRGPAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.17
4 0.14
5 0.13
6 0.14
7 0.13
8 0.11
9 0.11
10 0.18
11 0.17
12 0.18
13 0.18
14 0.18
15 0.19
16 0.23
17 0.24
18 0.19
19 0.2
20 0.21
21 0.24
22 0.26
23 0.28
24 0.28
25 0.27
26 0.28
27 0.32
28 0.29
29 0.27
30 0.3
31 0.3
32 0.27
33 0.27
34 0.25
35 0.21
36 0.23
37 0.22
38 0.18
39 0.16
40 0.16
41 0.17
42 0.18
43 0.18
44 0.2
45 0.22
46 0.23
47 0.31
48 0.29
49 0.27
50 0.29
51 0.28
52 0.26
53 0.24
54 0.26
55 0.2
56 0.2
57 0.22
58 0.19
59 0.21
60 0.18
61 0.2
62 0.17
63 0.15
64 0.15
65 0.15
66 0.16
67 0.14
68 0.14
69 0.12
70 0.12
71 0.18
72 0.2
73 0.21
74 0.21
75 0.22
76 0.21
77 0.2
78 0.19
79 0.12
80 0.09
81 0.07
82 0.06
83 0.06
84 0.06
85 0.05
86 0.06
87 0.08
88 0.1
89 0.13
90 0.13
91 0.15
92 0.18
93 0.22
94 0.26
95 0.27
96 0.32
97 0.32
98 0.33
99 0.33
100 0.34
101 0.3
102 0.29
103 0.32
104 0.3
105 0.29
106 0.29
107 0.31
108 0.32
109 0.39
110 0.42
111 0.45
112 0.43
113 0.48
114 0.49
115 0.52
116 0.49
117 0.43
118 0.37
119 0.28
120 0.26
121 0.22
122 0.2
123 0.13
124 0.12
125 0.12
126 0.14
127 0.14
128 0.13
129 0.13
130 0.19
131 0.22
132 0.26
133 0.3
134 0.33
135 0.41
136 0.47
137 0.49
138 0.53
139 0.58
140 0.63
141 0.68
142 0.72
143 0.66
144 0.68
145 0.66
146 0.62
147 0.64
148 0.57
149 0.49
150 0.42
151 0.44
152 0.36
153 0.39
154 0.34
155 0.27
156 0.26
157 0.25
158 0.24
159 0.19
160 0.18
161 0.13
162 0.16
163 0.14
164 0.14
165 0.16
166 0.15
167 0.18
168 0.19
169 0.2
170 0.19
171 0.22
172 0.25
173 0.28
174 0.35
175 0.38
176 0.43
177 0.47
178 0.51
179 0.51
180 0.49
181 0.52
182 0.53
183 0.52
184 0.5
185 0.49
186 0.45
187 0.41
188 0.38
189 0.31
190 0.27
191 0.25
192 0.2
193 0.19
194 0.19
195 0.18
196 0.18
197 0.18
198 0.15
199 0.13
200 0.15
201 0.14
202 0.17
203 0.17
204 0.18
205 0.18
206 0.23
207 0.27
208 0.25
209 0.27
210 0.3
211 0.32
212 0.34
213 0.33
214 0.27
215 0.26
216 0.27
217 0.23
218 0.21
219 0.19
220 0.2
221 0.23
222 0.26
223 0.23
224 0.23
225 0.23
226 0.22
227 0.26
228 0.26
229 0.3
230 0.3
231 0.33
232 0.33
233 0.33
234 0.3
235 0.24
236 0.22
237 0.18
238 0.18
239 0.13
240 0.15
241 0.15
242 0.14
243 0.14
244 0.13
245 0.1
246 0.07
247 0.07
248 0.05
249 0.05
250 0.04
251 0.05
252 0.05
253 0.07
254 0.11
255 0.1
256 0.11
257 0.11
258 0.13
259 0.13
260 0.19
261 0.21
262 0.21
263 0.24
264 0.25
265 0.29
266 0.28
267 0.27
268 0.24
269 0.2
270 0.17
271 0.14
272 0.13
273 0.09
274 0.09
275 0.1
276 0.07
277 0.07
278 0.06
279 0.06
280 0.06
281 0.05
282 0.04
283 0.04
284 0.04
285 0.04
286 0.04
287 0.04
288 0.05
289 0.07
290 0.08
291 0.08
292 0.07
293 0.08
294 0.08
295 0.08
296 0.07
297 0.06
298 0.07
299 0.07
300 0.07
301 0.06
302 0.06
303 0.07
304 0.07
305 0.07
306 0.06
307 0.06
308 0.06
309 0.07
310 0.07
311 0.06
312 0.06
313 0.08
314 0.08
315 0.08
316 0.08
317 0.07
318 0.07
319 0.07
320 0.07
321 0.05
322 0.05
323 0.04
324 0.05
325 0.05
326 0.05
327 0.04
328 0.04
329 0.03
330 0.03
331 0.03
332 0.02
333 0.02
334 0.03
335 0.03
336 0.03
337 0.03
338 0.03
339 0.04
340 0.06
341 0.06
342 0.07
343 0.07
344 0.08
345 0.14
346 0.15
347 0.17
348 0.16
349 0.18
350 0.19
351 0.19
352 0.19
353 0.13
354 0.12
355 0.1
356 0.09
357 0.06
358 0.05
359 0.05
360 0.08
361 0.09
362 0.11
363 0.13
364 0.21
365 0.25
366 0.31
367 0.33
368 0.32
369 0.34
370 0.36
371 0.34
372 0.31
373 0.36
374 0.33
375 0.34
376 0.35
377 0.34
378 0.31
379 0.31
380 0.27
381 0.19
382 0.16
383 0.14
384 0.13
385 0.1
386 0.1
387 0.1
388 0.09
389 0.09
390 0.09
391 0.09
392 0.07
393 0.07
394 0.06
395 0.05
396 0.05
397 0.05
398 0.04
399 0.05
400 0.05
401 0.05
402 0.06
403 0.06
404 0.06
405 0.06
406 0.07
407 0.06
408 0.06
409 0.06
410 0.06
411 0.06
412 0.05
413 0.06
414 0.05
415 0.05
416 0.05
417 0.05
418 0.06
419 0.07
420 0.07
421 0.06
422 0.06
423 0.08
424 0.07
425 0.08
426 0.06
427 0.08
428 0.09
429 0.1
430 0.1
431 0.09
432 0.09
433 0.09
434 0.09
435 0.09
436 0.1
437 0.09
438 0.11
439 0.11
440 0.12
441 0.15
442 0.16
443 0.19
444 0.24
445 0.32
446 0.31
447 0.35
448 0.38
449 0.37
450 0.39
451 0.37
452 0.31
453 0.27
454 0.31
455 0.3
456 0.29
457 0.26
458 0.26
459 0.26
460 0.28
461 0.26
462 0.21
463 0.17
464 0.17
465 0.19
466 0.17
467 0.16
468 0.14
469 0.14
470 0.15
471 0.15
472 0.15
473 0.14
474 0.15
475 0.14
476 0.13
477 0.11
478 0.09
479 0.09
480 0.16
481 0.18
482 0.18
483 0.19
484 0.23
485 0.28
486 0.31
487 0.32
488 0.34
489 0.3
490 0.35
491 0.35
492 0.3
493 0.31
494 0.29
495 0.29
496 0.24
497 0.23
498 0.18
499 0.18
500 0.2
501 0.2
502 0.2
503 0.2
504 0.18
505 0.17
506 0.16
507 0.17
508 0.15
509 0.1
510 0.11
511 0.08
512 0.1
513 0.13
514 0.14
515 0.19
516 0.21
517 0.27
518 0.26
519 0.26
520 0.24
521 0.22
522 0.29
523 0.24
524 0.23
525 0.18
526 0.22
527 0.23
528 0.25
529 0.27
530 0.2
531 0.18
532 0.2
533 0.19
534 0.16
535 0.17
536 0.15
537 0.13
538 0.13
539 0.15
540 0.12
541 0.16
542 0.17
543 0.16
544 0.17
545 0.16
546 0.17
547 0.15
548 0.15
549 0.17
550 0.15
551 0.13
552 0.13
553 0.13
554 0.14
555 0.17
556 0.17
557 0.13
558 0.15
559 0.16
560 0.16
561 0.21
562 0.2
563 0.19
564 0.2
565 0.19
566 0.18
567 0.18
568 0.22
569 0.23
570 0.23
571 0.23
572 0.22
573 0.24
574 0.24
575 0.25
576 0.22
577 0.18
578 0.17
579 0.17
580 0.18
581 0.17
582 0.23
583 0.3
584 0.35
585 0.43
586 0.53
587 0.61
588 0.7
589 0.78
590 0.82
591 0.83
592 0.87
593 0.88
594 0.89
595 0.89
596 0.86
597 0.82
598 0.73
599 0.66
600 0.57
601 0.49
602 0.4
603 0.37
604 0.37
605 0.34
606 0.39
607 0.42
608 0.5
609 0.5
610 0.5
611 0.49
612 0.41
613 0.39
614 0.37
615 0.35
616 0.33
617 0.36
618 0.44
619 0.5
620 0.59
621 0.65
622 0.71
623 0.72
624 0.7
625 0.73