Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8M0L0

Protein Details
Accession B8M0L0    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
96-116ITPLHRRTRARNNSLRTKPPSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011614  Catalase_core  
IPR020835  Catalase_sf  
Gene Ontology GO:0004096  F:catalase activity  
GO:0020037  F:heme binding  
Pfam View protein in Pfam  
PF00199  Catalase  
Amino Acid Sequences MKSVFFCRDPIQGPDVIRSQYRNPQNFLLDQDSLNTREDKRAGMMFFCDYGTPRRLEEHARLWLPYLQVVKSRTSTYSTPQPIRNRVNENGEFVYITPLHRRTRARNNSLRTKPPSLSGEDPDYPQRDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.3
4 0.29
5 0.28
6 0.3
7 0.35
8 0.43
9 0.44
10 0.44
11 0.46
12 0.48
13 0.46
14 0.45
15 0.41
16 0.32
17 0.28
18 0.26
19 0.24
20 0.22
21 0.22
22 0.2
23 0.17
24 0.2
25 0.21
26 0.19
27 0.19
28 0.21
29 0.2
30 0.18
31 0.19
32 0.16
33 0.15
34 0.15
35 0.12
36 0.1
37 0.13
38 0.15
39 0.14
40 0.14
41 0.15
42 0.17
43 0.2
44 0.23
45 0.24
46 0.27
47 0.27
48 0.26
49 0.25
50 0.25
51 0.22
52 0.2
53 0.17
54 0.12
55 0.15
56 0.17
57 0.18
58 0.18
59 0.19
60 0.17
61 0.2
62 0.2
63 0.21
64 0.28
65 0.32
66 0.34
67 0.4
68 0.45
69 0.5
70 0.54
71 0.56
72 0.53
73 0.51
74 0.55
75 0.5
76 0.47
77 0.4
78 0.35
79 0.3
80 0.24
81 0.23
82 0.16
83 0.16
84 0.17
85 0.21
86 0.24
87 0.3
88 0.36
89 0.41
90 0.52
91 0.61
92 0.66
93 0.69
94 0.75
95 0.79
96 0.82
97 0.82
98 0.78
99 0.73
100 0.65
101 0.63
102 0.58
103 0.54
104 0.51
105 0.47
106 0.46
107 0.42
108 0.44
109 0.44