Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5ZV60

Protein Details
Accession A0A2C5ZV60    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
18-44LLSRRPAKVRWLRARHRRRPNCTCALFHydrophilic
NLS Segment(s)
PositionSequence
11-36RRKLRLLLLSRRPAKVRWLRARHRRR
64-82RGKKKRGGSEERDIRSYRP
92-103GGARQRKKQGEA
Subcellular Location(s) mito 21, nucl 5
Family & Domain DBs
Amino Acid Sequences MAVAPGRDWARRKLRLLLLSRRPAKVRWLRARHRRRPNCTCALFCLPSPDGGECRPAAGCSTGRGKKKRGGSEERDIRSYRPSLGARGVVTGGARQRKKQGEAARGGTGKGGETGGDEVVGGGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.63
3 0.68
4 0.69
5 0.69
6 0.71
7 0.72
8 0.68
9 0.63
10 0.56
11 0.59
12 0.58
13 0.59
14 0.6
15 0.65
16 0.71
17 0.79
18 0.89
19 0.89
20 0.91
21 0.9
22 0.89
23 0.89
24 0.87
25 0.85
26 0.79
27 0.7
28 0.64
29 0.6
30 0.51
31 0.42
32 0.39
33 0.29
34 0.26
35 0.25
36 0.2
37 0.16
38 0.15
39 0.17
40 0.12
41 0.12
42 0.11
43 0.1
44 0.1
45 0.1
46 0.1
47 0.1
48 0.18
49 0.22
50 0.29
51 0.32
52 0.35
53 0.39
54 0.46
55 0.51
56 0.52
57 0.55
58 0.55
59 0.62
60 0.67
61 0.63
62 0.59
63 0.53
64 0.46
65 0.41
66 0.36
67 0.27
68 0.25
69 0.24
70 0.23
71 0.24
72 0.26
73 0.22
74 0.21
75 0.2
76 0.14
77 0.14
78 0.14
79 0.16
80 0.23
81 0.24
82 0.26
83 0.34
84 0.4
85 0.44
86 0.49
87 0.53
88 0.53
89 0.58
90 0.6
91 0.58
92 0.52
93 0.49
94 0.42
95 0.33
96 0.25
97 0.19
98 0.15
99 0.09
100 0.1
101 0.11
102 0.1
103 0.09
104 0.08
105 0.07