Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5ZJT4

Protein Details
Accession A0A2C5ZJT4    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MCPDRRRRRHERRPSPSLPPGPABasic
NLS Segment(s)
PositionSequence
5-15RRRRRHERRPS
Subcellular Location(s) mito 16, cyto 6, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR018626  LCHN/Anr2  
Pfam View protein in Pfam  
PF09804  DENND11  
Amino Acid Sequences MCPDRRRRRHERRPSPSLPPGPAADRPPLSALFLVDFDVKAGYTIAWRRALPGLELDGRVEYKSLPSGLHTVARDLVYFVHDGAHAGLSAFVNEPCDEEEARHARMIAVGVLVPLSYGRLGRAWRHAENLELMAAKLAKDRNMTEVLERYWLANKADDAAAAASPPEASPDLPASPALDRNTGCRPITRPGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.86
3 0.85
4 0.8
5 0.72
6 0.64
7 0.57
8 0.51
9 0.5
10 0.44
11 0.4
12 0.34
13 0.33
14 0.32
15 0.29
16 0.26
17 0.23
18 0.2
19 0.15
20 0.14
21 0.14
22 0.12
23 0.11
24 0.1
25 0.09
26 0.08
27 0.07
28 0.07
29 0.06
30 0.09
31 0.13
32 0.17
33 0.2
34 0.2
35 0.22
36 0.25
37 0.25
38 0.22
39 0.2
40 0.19
41 0.18
42 0.18
43 0.17
44 0.15
45 0.15
46 0.14
47 0.12
48 0.09
49 0.08
50 0.09
51 0.1
52 0.09
53 0.1
54 0.12
55 0.13
56 0.17
57 0.16
58 0.15
59 0.16
60 0.16
61 0.15
62 0.12
63 0.12
64 0.09
65 0.09
66 0.08
67 0.07
68 0.06
69 0.07
70 0.07
71 0.06
72 0.05
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.06
80 0.06
81 0.07
82 0.06
83 0.08
84 0.08
85 0.08
86 0.13
87 0.14
88 0.15
89 0.15
90 0.14
91 0.13
92 0.13
93 0.13
94 0.08
95 0.06
96 0.05
97 0.05
98 0.04
99 0.04
100 0.03
101 0.03
102 0.03
103 0.03
104 0.04
105 0.04
106 0.07
107 0.09
108 0.11
109 0.19
110 0.24
111 0.25
112 0.28
113 0.28
114 0.27
115 0.27
116 0.25
117 0.19
118 0.14
119 0.12
120 0.1
121 0.1
122 0.09
123 0.11
124 0.11
125 0.13
126 0.15
127 0.16
128 0.19
129 0.22
130 0.23
131 0.22
132 0.24
133 0.23
134 0.23
135 0.22
136 0.19
137 0.2
138 0.23
139 0.21
140 0.2
141 0.19
142 0.19
143 0.19
144 0.18
145 0.15
146 0.12
147 0.11
148 0.09
149 0.09
150 0.06
151 0.06
152 0.06
153 0.08
154 0.08
155 0.08
156 0.11
157 0.14
158 0.14
159 0.15
160 0.15
161 0.15
162 0.16
163 0.21
164 0.21
165 0.23
166 0.23
167 0.27
168 0.34
169 0.37
170 0.36
171 0.36
172 0.38