Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C5YIW6

Protein Details
Accession A0A2C5YIW6   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
54-74QNLKNTRERNRNRRDNWPPQSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto 5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000089  Biotin_lipoyl  
IPR011053  Single_hybrid_motif  
Pfam View protein in Pfam  
PF00364  Biotin_lipoyl  
CDD cd06849  lipoyl_domain  
Amino Acid Sequences MAESIAEGTLKQFSKNVGDFVEQDEEIATIETDKIDVAVNAPQSGNKTWQNSLQNLKNTRERNRNRRDNWPPQSICHPSGQRRIRGLNLLLTQIIAKRVVSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.26
4 0.22
5 0.24
6 0.24
7 0.26
8 0.27
9 0.2
10 0.18
11 0.16
12 0.14
13 0.12
14 0.12
15 0.08
16 0.05
17 0.05
18 0.05
19 0.05
20 0.05
21 0.05
22 0.05
23 0.05
24 0.05
25 0.07
26 0.08
27 0.09
28 0.09
29 0.09
30 0.11
31 0.12
32 0.16
33 0.17
34 0.19
35 0.19
36 0.25
37 0.28
38 0.29
39 0.34
40 0.34
41 0.37
42 0.39
43 0.41
44 0.43
45 0.45
46 0.49
47 0.54
48 0.59
49 0.63
50 0.7
51 0.77
52 0.74
53 0.79
54 0.81
55 0.82
56 0.8
57 0.79
58 0.7
59 0.62
60 0.66
61 0.6
62 0.53
63 0.49
64 0.48
65 0.45
66 0.54
67 0.57
68 0.56
69 0.55
70 0.57
71 0.54
72 0.53
73 0.49
74 0.46
75 0.41
76 0.36
77 0.31
78 0.27
79 0.25
80 0.2
81 0.2
82 0.14