Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C6AJS3

Protein Details
Accession A0A2C6AJS3    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-33PSSPTMPPSGPRKRRWSRRAVMVSTHydrophilic
NLS Segment(s)
PositionSequence
19-25PRKRRWS
Subcellular Location(s) plas 9, mito 8, nucl 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR017946  PLC-like_Pdiesterase_TIM-brl  
Gene Ontology GO:0008081  F:phosphoric diester hydrolase activity  
GO:0006629  P:lipid metabolic process  
Amino Acid Sequences MAAPPGHRPSSPTMPPSGPRKRRWSRRAVMVSTAAAATSLLGLVLLLGFPSSYRAGSMSVLSWPSSSSPPPPLDRISLASSGSEADCPGRSLAFSFDAAAGQHAAWMASVPDATPLTSLSIPGSHDSLTYNMAADGPLRCQNANLSAQLAAGLRRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.49
3 0.56
4 0.59
5 0.59
6 0.61
7 0.69
8 0.75
9 0.82
10 0.85
11 0.86
12 0.83
13 0.85
14 0.86
15 0.78
16 0.72
17 0.63
18 0.54
19 0.44
20 0.36
21 0.25
22 0.16
23 0.12
24 0.07
25 0.05
26 0.04
27 0.03
28 0.03
29 0.03
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.05
38 0.06
39 0.06
40 0.06
41 0.07
42 0.08
43 0.09
44 0.1
45 0.08
46 0.09
47 0.1
48 0.1
49 0.09
50 0.08
51 0.09
52 0.1
53 0.11
54 0.12
55 0.15
56 0.18
57 0.2
58 0.22
59 0.22
60 0.22
61 0.22
62 0.23
63 0.2
64 0.18
65 0.17
66 0.14
67 0.13
68 0.11
69 0.1
70 0.08
71 0.06
72 0.06
73 0.06
74 0.07
75 0.07
76 0.06
77 0.06
78 0.07
79 0.08
80 0.09
81 0.09
82 0.08
83 0.08
84 0.09
85 0.09
86 0.09
87 0.07
88 0.06
89 0.06
90 0.05
91 0.05
92 0.05
93 0.05
94 0.04
95 0.04
96 0.04
97 0.04
98 0.06
99 0.07
100 0.07
101 0.07
102 0.07
103 0.1
104 0.1
105 0.1
106 0.09
107 0.1
108 0.11
109 0.12
110 0.13
111 0.11
112 0.11
113 0.12
114 0.12
115 0.13
116 0.12
117 0.11
118 0.1
119 0.1
120 0.09
121 0.1
122 0.1
123 0.12
124 0.17
125 0.19
126 0.19
127 0.19
128 0.22
129 0.27
130 0.28
131 0.26
132 0.22
133 0.2
134 0.2
135 0.21
136 0.19