Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C6A1I5

Protein Details
Accession A0A2C6A1I5    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
100-122GTCLMSQTTRRHQRRPERCAGVGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9.5, nucl 9, cyto 8, mito 4, cysk 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR025856  HeH/LEM_domain  
IPR044780  Heh2/Src1  
IPR011015  LEM/LEM-like_dom_sf  
Gene Ontology GO:0005637  C:nuclear inner membrane  
GO:0003682  F:chromatin binding  
Pfam View protein in Pfam  
PF12949  HeH  
CDD cd12935  LEM_like  
Amino Acid Sequences MVDGDDYLQEGFDPRSVTVPRLRSILVTHNVDFPSTAKKPQLVELVTDHVLSQAPKLRADRARAKRSSYGIVNAGSADDTNTWDEHELPPPSAVHDLRVGTCLMSQTTRRHQRRPERCAGVGGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.17
3 0.18
4 0.22
5 0.27
6 0.3
7 0.29
8 0.3
9 0.3
10 0.26
11 0.27
12 0.32
13 0.31
14 0.31
15 0.3
16 0.32
17 0.32
18 0.31
19 0.28
20 0.21
21 0.23
22 0.2
23 0.22
24 0.2
25 0.23
26 0.24
27 0.28
28 0.33
29 0.26
30 0.26
31 0.25
32 0.26
33 0.24
34 0.23
35 0.18
36 0.13
37 0.13
38 0.11
39 0.11
40 0.13
41 0.14
42 0.16
43 0.17
44 0.23
45 0.26
46 0.32
47 0.4
48 0.43
49 0.51
50 0.5
51 0.53
52 0.51
53 0.5
54 0.48
55 0.39
56 0.32
57 0.26
58 0.24
59 0.21
60 0.17
61 0.14
62 0.11
63 0.09
64 0.07
65 0.05
66 0.06
67 0.07
68 0.07
69 0.08
70 0.08
71 0.1
72 0.11
73 0.16
74 0.16
75 0.16
76 0.17
77 0.17
78 0.18
79 0.21
80 0.2
81 0.16
82 0.18
83 0.19
84 0.18
85 0.19
86 0.18
87 0.13
88 0.14
89 0.14
90 0.12
91 0.14
92 0.18
93 0.24
94 0.34
95 0.45
96 0.51
97 0.58
98 0.67
99 0.75
100 0.81
101 0.83
102 0.83
103 0.8
104 0.75