Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C6A3C7

Protein Details
Accession A0A2C6A3C7    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
357-384DCSDRRARTAAKRKRGKKCPIRHTTTLEHydrophilic
NLS Segment(s)
PositionSequence
362-374RARTAAKRKRGKK
Subcellular Location(s) nucl 10.5, mito 10, cyto_nucl 9.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014752  Arrestin-like_C  
IPR039634  Bul1-like  
Amino Acid Sequences MVPQHTTDIVIPRLGARSKPAAQQKPAVSIKIDGHFSSKVYTSGSAVSGHAVVCTQRDTPFDDLDIIFTGIAATRLDFVQQYPSHSFRPFMKLRMPIATSALPEPRLFEAAKTYTIPFNFVVPHQLTLGACTHPCTSPAVREHHLRLPPTVGFWEADDQAPEMAQIEYAVKARVYRRPDAGGAPTKIMEGYHMVKVLPALPEDAPLDITFRDERYNLSKSKTIRKNLFSAKAGKLTATASQPGAVMLSPDGHGASTTMARIDLDFAPSSVDQAPPKITSVAAKLTSATFFGAAPTDLLPNLGSRSVYTANPSLSYTTTSALFSESVGKLAWQQRNTTGRRDSGYSSLGIDEYVSETDCSDRRARTAAKRKRGKKCPIRHTTTLEIPFTIPTTNRKLFLPTFHSCLISRTYTLHLSLSAGPANTALTLAIPLQIGVETVHPPPDDGGLPSFESAVAEGDEGDVDAHLRPRLLRIPDRPRPSNGILPGYDELSRRAIAVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.25
4 0.31
5 0.35
6 0.43
7 0.51
8 0.54
9 0.56
10 0.63
11 0.61
12 0.63
13 0.62
14 0.56
15 0.47
16 0.43
17 0.44
18 0.4
19 0.4
20 0.31
21 0.31
22 0.3
23 0.29
24 0.28
25 0.24
26 0.2
27 0.2
28 0.2
29 0.18
30 0.18
31 0.19
32 0.17
33 0.16
34 0.16
35 0.15
36 0.14
37 0.12
38 0.11
39 0.1
40 0.1
41 0.13
42 0.13
43 0.15
44 0.17
45 0.21
46 0.24
47 0.25
48 0.24
49 0.25
50 0.23
51 0.22
52 0.21
53 0.17
54 0.13
55 0.11
56 0.1
57 0.08
58 0.09
59 0.07
60 0.06
61 0.07
62 0.07
63 0.09
64 0.09
65 0.09
66 0.17
67 0.18
68 0.23
69 0.27
70 0.31
71 0.33
72 0.34
73 0.36
74 0.32
75 0.4
76 0.38
77 0.37
78 0.41
79 0.43
80 0.45
81 0.48
82 0.45
83 0.37
84 0.38
85 0.35
86 0.3
87 0.27
88 0.27
89 0.22
90 0.21
91 0.22
92 0.2
93 0.21
94 0.19
95 0.17
96 0.2
97 0.2
98 0.22
99 0.21
100 0.22
101 0.23
102 0.23
103 0.25
104 0.19
105 0.19
106 0.18
107 0.17
108 0.22
109 0.19
110 0.2
111 0.17
112 0.19
113 0.17
114 0.18
115 0.19
116 0.14
117 0.13
118 0.14
119 0.16
120 0.14
121 0.15
122 0.18
123 0.17
124 0.22
125 0.28
126 0.31
127 0.33
128 0.37
129 0.41
130 0.43
131 0.46
132 0.41
133 0.37
134 0.35
135 0.32
136 0.28
137 0.25
138 0.19
139 0.15
140 0.14
141 0.16
142 0.13
143 0.13
144 0.12
145 0.11
146 0.1
147 0.1
148 0.09
149 0.07
150 0.06
151 0.05
152 0.05
153 0.05
154 0.07
155 0.08
156 0.08
157 0.08
158 0.11
159 0.14
160 0.2
161 0.24
162 0.27
163 0.29
164 0.31
165 0.33
166 0.32
167 0.36
168 0.37
169 0.32
170 0.3
171 0.27
172 0.24
173 0.22
174 0.2
175 0.14
176 0.1
177 0.12
178 0.12
179 0.13
180 0.12
181 0.12
182 0.13
183 0.14
184 0.11
185 0.09
186 0.1
187 0.09
188 0.11
189 0.11
190 0.11
191 0.09
192 0.08
193 0.09
194 0.07
195 0.09
196 0.08
197 0.09
198 0.1
199 0.1
200 0.12
201 0.17
202 0.21
203 0.21
204 0.23
205 0.26
206 0.28
207 0.38
208 0.44
209 0.46
210 0.49
211 0.5
212 0.54
213 0.57
214 0.59
215 0.52
216 0.5
217 0.44
218 0.4
219 0.37
220 0.3
221 0.24
222 0.2
223 0.2
224 0.15
225 0.14
226 0.11
227 0.11
228 0.11
229 0.1
230 0.09
231 0.06
232 0.05
233 0.04
234 0.05
235 0.05
236 0.05
237 0.05
238 0.04
239 0.05
240 0.05
241 0.05
242 0.05
243 0.05
244 0.05
245 0.05
246 0.05
247 0.05
248 0.07
249 0.07
250 0.08
251 0.08
252 0.08
253 0.1
254 0.1
255 0.11
256 0.09
257 0.11
258 0.1
259 0.11
260 0.13
261 0.11
262 0.12
263 0.11
264 0.11
265 0.1
266 0.12
267 0.14
268 0.13
269 0.13
270 0.13
271 0.13
272 0.13
273 0.12
274 0.1
275 0.07
276 0.06
277 0.06
278 0.06
279 0.06
280 0.06
281 0.06
282 0.06
283 0.06
284 0.06
285 0.06
286 0.06
287 0.07
288 0.07
289 0.07
290 0.06
291 0.1
292 0.11
293 0.12
294 0.14
295 0.15
296 0.15
297 0.16
298 0.17
299 0.15
300 0.13
301 0.15
302 0.13
303 0.12
304 0.12
305 0.12
306 0.11
307 0.11
308 0.11
309 0.09
310 0.13
311 0.12
312 0.11
313 0.11
314 0.11
315 0.15
316 0.23
317 0.28
318 0.25
319 0.26
320 0.33
321 0.42
322 0.44
323 0.45
324 0.42
325 0.4
326 0.4
327 0.41
328 0.36
329 0.31
330 0.31
331 0.24
332 0.21
333 0.18
334 0.16
335 0.13
336 0.11
337 0.07
338 0.07
339 0.07
340 0.07
341 0.07
342 0.07
343 0.09
344 0.1
345 0.14
346 0.17
347 0.17
348 0.18
349 0.24
350 0.3
351 0.38
352 0.49
353 0.55
354 0.61
355 0.71
356 0.79
357 0.84
358 0.88
359 0.89
360 0.88
361 0.89
362 0.9
363 0.9
364 0.88
365 0.84
366 0.8
367 0.75
368 0.72
369 0.66
370 0.56
371 0.47
372 0.39
373 0.33
374 0.28
375 0.23
376 0.17
377 0.17
378 0.25
379 0.27
380 0.27
381 0.28
382 0.32
383 0.33
384 0.38
385 0.4
386 0.35
387 0.37
388 0.37
389 0.39
390 0.33
391 0.33
392 0.31
393 0.26
394 0.23
395 0.21
396 0.23
397 0.23
398 0.23
399 0.22
400 0.18
401 0.19
402 0.19
403 0.19
404 0.17
405 0.15
406 0.14
407 0.13
408 0.13
409 0.11
410 0.09
411 0.07
412 0.05
413 0.06
414 0.06
415 0.07
416 0.07
417 0.07
418 0.07
419 0.07
420 0.07
421 0.07
422 0.09
423 0.1
424 0.11
425 0.14
426 0.14
427 0.15
428 0.15
429 0.17
430 0.16
431 0.16
432 0.17
433 0.16
434 0.17
435 0.16
436 0.16
437 0.13
438 0.13
439 0.11
440 0.1
441 0.08
442 0.07
443 0.07
444 0.07
445 0.07
446 0.07
447 0.06
448 0.05
449 0.06
450 0.07
451 0.1
452 0.11
453 0.13
454 0.13
455 0.18
456 0.26
457 0.33
458 0.4
459 0.48
460 0.57
461 0.66
462 0.74
463 0.74
464 0.72
465 0.72
466 0.69
467 0.67
468 0.62
469 0.59
470 0.5
471 0.5
472 0.46
473 0.4
474 0.37
475 0.3
476 0.27
477 0.24
478 0.24