Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C6AAE1

Protein Details
Accession A0A2C6AAE1    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
40-62DMTFACKKCKKCFRKDTQEFEESHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008913  Znf_CHY  
IPR037274  Znf_CHY_sf  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF05495  zf-CHY  
PROSITE View protein in PROSITE  
PS51266  ZF_CHY  
Amino Acid Sequences MCKHILNAQVAIRSPCCRKWFDCADCHREQESHPLLQSTDMTFACKKCKKCFRKDTQEFEESDEYCPHCDNHFVIDAKTPKAALSVESDDVRMDNKMLKDGRTKQSKLRSIFDPDEDADRLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.35
3 0.37
4 0.39
5 0.39
6 0.44
7 0.52
8 0.53
9 0.57
10 0.58
11 0.62
12 0.6
13 0.61
14 0.55
15 0.46
16 0.41
17 0.42
18 0.38
19 0.32
20 0.29
21 0.26
22 0.24
23 0.24
24 0.24
25 0.16
26 0.15
27 0.13
28 0.15
29 0.16
30 0.17
31 0.25
32 0.3
33 0.33
34 0.39
35 0.5
36 0.56
37 0.65
38 0.74
39 0.76
40 0.82
41 0.86
42 0.85
43 0.81
44 0.76
45 0.65
46 0.58
47 0.5
48 0.39
49 0.32
50 0.25
51 0.19
52 0.16
53 0.16
54 0.13
55 0.11
56 0.12
57 0.11
58 0.12
59 0.16
60 0.16
61 0.16
62 0.21
63 0.22
64 0.22
65 0.22
66 0.19
67 0.15
68 0.15
69 0.15
70 0.11
71 0.13
72 0.15
73 0.17
74 0.17
75 0.18
76 0.16
77 0.16
78 0.16
79 0.11
80 0.1
81 0.12
82 0.12
83 0.19
84 0.2
85 0.23
86 0.31
87 0.39
88 0.47
89 0.52
90 0.55
91 0.57
92 0.65
93 0.71
94 0.67
95 0.64
96 0.6
97 0.59
98 0.6
99 0.55
100 0.49
101 0.42
102 0.41