Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8MDQ0

Protein Details
Accession B8MDQ0    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
62-83QKSFRTKQKLAKAQKQNRPIPQHydrophilic
88-109RTGNTIRYNAKRRHWRKTRLGIHydrophilic
NLS Segment(s)
PositionSequence
97-105AKRRHWRKT
Subcellular Location(s) mito 22, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MLRNFKAFAHKFIMLASTGAILSSGLPRQERPDDTQKKIETACVQRSAGISNERQAIKMPSQKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.15
4 0.1
5 0.08
6 0.08
7 0.07
8 0.06
9 0.06
10 0.08
11 0.09
12 0.1
13 0.12
14 0.13
15 0.18
16 0.23
17 0.26
18 0.3
19 0.4
20 0.45
21 0.48
22 0.55
23 0.51
24 0.49
25 0.46
26 0.43
27 0.38
28 0.37
29 0.37
30 0.32
31 0.32
32 0.3
33 0.3
34 0.28
35 0.23
36 0.2
37 0.16
38 0.15
39 0.2
40 0.18
41 0.18
42 0.18
43 0.18
44 0.19
45 0.25
46 0.25
47 0.26
48 0.31
49 0.34
50 0.39
51 0.45
52 0.5
53 0.53
54 0.58
55 0.6
56 0.66
57 0.72
58 0.75
59 0.77
60 0.78
61 0.79
62 0.82
63 0.83
64 0.81
65 0.79
66 0.76
67 0.74
68 0.69
69 0.68
70 0.69
71 0.63
72 0.62
73 0.58
74 0.55
75 0.54
76 0.56
77 0.55
78 0.51
79 0.53
80 0.54
81 0.59
82 0.65
83 0.65
84 0.67
85 0.7
86 0.74
87 0.79
88 0.82
89 0.83