Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2C6A6S0

Protein Details
Accession A0A2C6A6S0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
20-59VLSCRGSGRRRRRPEALRTARGRKQPSDRCRRRPPPSAPHBasic
NLS Segment(s)
PositionSequence
26-64SGRRRRRPEALRTARGRKQPSDRCRRRPPPSAPHGPGRP
Subcellular Location(s) mito 14, extr 8, mito_nucl 8
Family & Domain DBs
Amino Acid Sequences MQQAATGEAAGAHVGSAALVLSCRGSGRRRRRPEALRTARGRKQPSDRCRRRPPPSAPHGPGRPVLGPGHGRVPSAVATGRAWACACRRMRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.04
8 0.04
9 0.04
10 0.05
11 0.09
12 0.16
13 0.26
14 0.37
15 0.48
16 0.56
17 0.63
18 0.72
19 0.77
20 0.8
21 0.82
22 0.8
23 0.78
24 0.75
25 0.76
26 0.72
27 0.71
28 0.65
29 0.59
30 0.59
31 0.61
32 0.64
33 0.68
34 0.71
35 0.74
36 0.81
37 0.85
38 0.82
39 0.82
40 0.81
41 0.8
42 0.79
43 0.79
44 0.72
45 0.7
46 0.65
47 0.58
48 0.51
49 0.43
50 0.35
51 0.28
52 0.25
53 0.22
54 0.21
55 0.2
56 0.25
57 0.22
58 0.22
59 0.2
60 0.21
61 0.17
62 0.17
63 0.17
64 0.13
65 0.12
66 0.17
67 0.17
68 0.17
69 0.17
70 0.19
71 0.21
72 0.27